KEGG   Nonlabens sp. MB-3u-79: CW736_03210Help
Entry
CW736_03210       CDS       T05253                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nob  Nonlabens sp. MB-3u-79
Pathway
nob00020  Citrate cycle (TCA cycle)
nob00310  Lysine degradation
nob00380  Tryptophan metabolism
nob01100  Metabolic pathways
nob01110  Biosynthesis of secondary metabolites
nob01120  Microbial metabolism in diverse environments
nob01130  Biosynthesis of antibiotics
nob01200  Carbon metabolism
Module
nob_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nob_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nob00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CW736_03210
  Amino acid metabolism
   00310 Lysine degradation
    CW736_03210
   00380 Tryptophan metabolism
    CW736_03210
Enzymes [BR:nob01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CW736_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AUC78468
UniProt: A0A2K8X6C2
LinkDB All DBs
Position
complement(724562..727309)
Genome map
AA seq 915 aa AA seqDB search
MDKFSFLNAAHTAYFAQLYDEYLINPDQVEPSWRSFFQGFDFGMESAHEGDLVVEHEGAS
VGVPENLQKEFQVVKLIDAYRSRGHLFTKTNPVRERRNYEPKLDLVNFGLSDADLDTPFN
SGELINLGRTSLRNIIAHLNKVYCESIGVEYMYIRKPDEIKWIQNWLHKNDNHPAFNKDQ
KLQILKKLNEAVSFETFLHTKYVGQKRFSLEGNESLIPALDALIENAADKGVDQFVLGMA
HRGRLNVLTNIFGKPVKDIFSEFDGKDYEQDIFDGDVKYHLGYTSKRKTDNGNDININIV
PNPSHLEAVGAVVEGIARAKQDRHTPENFSKVLPIVIHGDAAIAGQGIVYEVVQMAQLDA
YKTAGTIHLVVNNQVGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADDAEAVVHAMNFAL
DYRMEFARDVFIDLLGYRKYGHNEGDEPRFTQPQLYKAIAKQKNPCDIYAERLLQEGVIN
NSKVKELESQYKNRLEEELVTSRQMENTLITPFMQDEWEGFEPATEIEMMKKVATGVDRA
VLEKITKTISQLPKGESFIRKVKKIIESRQAMFDNDKLDWAMGEHLAYGSLMMEGFDVRM
SGQDIERGTFSHRHAVVKSENQENEFILHNHIDGVKGNMDIYNSHLSEYAVVGFEYGYAL
ARPNTLTIWEAQFGDFSNGAQIVMDQYISAGEDKWKNQNGLVKLLPHGYEGQGAEHSSAR
IERYLQLCAKDNMFMANCTTPANLFHLLRRQMLVNYRKPLVVFTPKSLLRSPRAVSKVSE
LEQGHFQEVIDVDGDAFAKAETLVFVSGKFYYDLLEYREENNRTDVALVRLEQLFPLPVE
QMQEIIKKYGSKDVVWAQEEPRNMGAYSHLMLHMPETRTWRVCSRNMYAAPASGSSTRSK
RRQARIIEDVFNTNK
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggacaagttttcatttctaaatgcagcacatactgcatacttcgcacaactttatgat
gaatatctaattaatccagaccaggtagagccttcatggcgttccttttttcaaggtttt
gattttggaatggagagcgctcacgagggcgacctagtagtagagcatgaaggtgcttcg
gtgggtgttccagaaaacttacagaaagaatttcaagttgtaaaattaattgatgcgtat
cgatcaagaggtcatttgtttactaaaacaaatccagttagagagcgccgtaattatgag
cctaagctagacctggtcaactttggtctttctgatgcagacttagacactccttttaat
tcaggagaattaataaacttgggaagaaccagtcttaggaacatcattgctcaccttaat
aaagtgtattgtgagagtataggggtggagtacatgtacatacgcaaaccagatgagatc
aaatggatccaaaactggttgcacaaaaatgacaatcatcctgcttttaataaagatcaa
aaattacagattcttaagaagctgaatgaagccgtttcttttgaaactttccttcatact
aaatatgtgggacagaaacgtttttctctagaaggaaatgaatcattaattcctgcactt
gatgccctaattgaaaatgctgctgacaaaggagtggatcaatttgtactgggtatggcg
caccgtggccgattaaatgtattgactaatatttttggcaagcccgtaaaggatattttc
tcagaatttgacgggaaagattacgaacaagatatttttgatggtgatgtcaaataccac
ttggggtataccagtaaaagaaaaacagataacggcaacgatatcaatatcaatatagtt
cctaatccgtctcatttagaggcggtaggtgccgtagtagagggaatagctcgtgccaaa
caagacagacataccccagagaacttctctaaagtattgcccattgtaattcatggtgac
gcggctattgctggtcagggaatcgtttatgaagtggtgcaaatggcacaattagacgct
tataaaacagcaggaaccatacacttagtggttaacaatcaagtaggctttactactaat
tatctagatgcaagatccagtacgtactgtacagatgttgctaaggtaactttatcacca
gtacttcacgtaaatgcagacgatgctgaagcagtggttcacgcgatgaattttgcgctg
gattaccgtatggaatttgctagggatgtgtttattgatttattaggctatagaaaatac
ggtcataatgaaggtgatgagcctcgttttacacagccacaattatataaagcgatcgct
aagcaaaagaatccatgtgatatttatgcagagagattgcttcaagaaggagtgattaat
aactccaaggtcaaagaattagaaagtcaatacaaaaacagactggaagaggagttagtg
acctcaagacaaatggagaataccttgattactccatttatgcaagatgaatgggaaggt
tttgaaccggctacagaaatagagatgatgaaaaaagtagctactggtgtagaccgtgct
gttttagaaaaaatcactaaaaccatttctcaactcccaaaaggagaatcttttattagg
aaagtaaaaaagattattgaatcccgtcaggctatgtttgataatgataagctggactgg
gcaatgggcgagcaccttgcttacggtagtttgatgatggaaggctttgatgtacgtatg
agtggacaggatatagaaagaggtactttttctcaccgtcacgcagtcgtaaaatcagag
aatcaagagaacgaattcattttacacaatcatatcgatggtgtaaaaggaaacatggat
atatacaattcacacctgtcagagtatgcggtggtaggttttgaatatggttatgcctta
gcaagacctaacaccttgactatttgggaagcacaatttggagatttctctaacggtgct
caaatcgttatggatcagtacatcagtgctggagaagataaatggaagaatcagaatggt
ctggtaaaattattaccacacggttatgaaggtcaaggagcagagcattccagtgcgcgt
atagaacgttatttacagttgtgtgcaaaggacaatatgtttatggccaactgtaccacg
ccagcaaacttgtttcacctattacgtcgtcagatgttggtcaattaccgcaagcctttg
gtggtgtttactcctaaatctttgttgcgttctcctagagcagtaagcaaggtgtctgaa
ctggagcaagggcattttcaagaagttattgatgtggatggtgacgctttcgcgaaagcg
gaaacattagtatttgtatcaggaaaattctattacgatcttttagaatacagagaagaa
aataacagaacagacgttgccttagtaagactagaacaattattcccgcttccggtagaa
caaatgcaagaaataattaaaaaatacggttctaaagatgtcgtttgggcacaagaagaa
cctagaaatatgggagcatattcccacttgatgttacacatgccagaaacaagaacatgg
cgcgtgtgctcaagaaatatgtacgcagcccctgcttcaggaagttccacaagatctaag
agaagacaggcaagaataatagaagatgtatttaataccaacaaataa

DBGET integrated database retrieval system