KEGG   Nonlabens sp. MB-3u-79: CW736_04645Help
Entry
CW736_04645       CDS       T05253                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
nob  Nonlabens sp. MB-3u-79
Pathway
nob00240  Pyrimidine metabolism
nob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nob00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CW736_04645
Enzymes [BR:nob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CW736_04645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AUC78724
UniProt: A0A2K8X723
LinkDB All DBs
Position
1028998..1029633
Genome map
AA seq 211 aa AA seqDB search
MFLENTVNHEEQFGWIEVICGSMFSGKTEELIRRLKRAQFAQQKVEIFKPSIDVRYDEEM
VVSHDSNEIPSTPVPAAANIPLLASDCQVVGIDEAQFFDDEIVAVCNALANRGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLAQYSYRKTADEKVVMLGEQQEYEP
LSRAAYYKAMLSDKLKDTDVKTDQVNDKNTS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagaaaatacggttaatcatgaagagcaatttggctggatcgaagtaatttgt
ggttccatgttctctggtaaaacagaagaattgatcagacgtttaaaaagagcgcagttt
gcacagcaaaaagtagagatttttaaaccttctattgacgtgcgatacgatgaagaaatg
gtagtttctcacgattctaacgagattccgagtacaccagttcctgctgcggcaaacatc
ccacttcttgcaagtgactgtcaagttgtaggaatagacgaagcccagttttttgatgat
gaaatagttgcggtgtgtaatgctcttgcaaatcgcggtatacgagtgattgtggccgga
ttagatatggactttaaaggaaacccctttggtccgatgcctgcactgatggcaacagca
gagtatgtcactaaagttcacgcggtttgtactagaacaggaaatctagcccagtattct
taccgcaaaactgctgatgaaaaagtagtcatgttaggagagcaacaagaatacgaaccc
ttgagtcgggcagcttactataaagccatgctttctgacaaattgaaagatacagacgta
aagacggatcaagtgaatgataaaaacacctcctaa

DBGET integrated database retrieval system