KEGG   Nonlabens sp. MB-3u-79: CW736_10850Help
Entry
CW736_10850       CDS       T05253                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nob  Nonlabens sp. MB-3u-79
Pathway
nob00620  Pyruvate metabolism
nob00680  Methane metabolism
nob01100  Metabolic pathways
nob01120  Microbial metabolism in diverse environments
nob01200  Carbon metabolism
Module
nob_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CW736_10850
  09102 Energy metabolism
   00680 Methane metabolism
    CW736_10850
Enzymes [BR:nob01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CW736_10850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: AUC79828
UniProt: A0A2K8XAA3
LinkDB All DBs
Position
complement(2460120..2462684)
Genome map
AA seq 854 aa AA seqDB search
MSRLPKIERFKNEVESKYQIFNGIFMTLPFDQISNTGGLLPLFHEMCVKGYEKGKNPTEI
VEYFFERYMRDTSPKEREDMLFRFIQYIERQVVLFDAIEDAAFSKVNNIDGRGSLRSVKE
EAVELNKTEELAAYLKEFKVRPVLTAHPTQFYPGSVLGIINDLGDAIKANQLQEVKLLLS
QLGKTPFFKKEKPTPFDEAVSLIWYLEHVFYQAMGNIYDYLKTHIENPQEFKNQIVEIGF
WPGGDRDGNPFVTTAITINVAKRLRSTIFRNYYRDLRKLRRRLTFKGVEEQLAALESMCY
KAIFEKDVLEFAPQDLIDRMNEIRSTVIEQHNSLFLGQIDSFIHKIELFGFHFATLDIRQ
DSSAHDAVFDEILAFAKAKLPTNYNSLSEEEKVNVLAQVEGSIDPKDFTDDYTQRTLSSI
YAIKNIQERNGEKGCNRYIISNTQMASQIMEVYAMIRLCNMPQPKIDVVPLFETVPDLIK
APDVMRSLYENEHYRAHVKRRDDTQHIMLGFSDGTKDGGYLMANWAIYEAKEALSTVSRE
YGISIVFFDGRGGPPARGGGQTHQFYASMGTKIEAKHIQLTVQGQTISSKFGTLESCQYN
LEQMISSGVSNAVYASDANDFSEKDKATMDQLAKSSYIAYTDFKAHPQFLSYLEQMSTLK
YYAKTNIGSRPSKRAGSAELRFKDLRAIPFVGSWSQLKQNVPGFYGVGTALETMDKAGNW
EAAEELYKNNKFFRTLLDNSMMSLTKSFFALTAYMEHDPIYGEFWKMIYAEYERSKKYML
KISGMKTLMENEPAGRASIQAREKIVLPLLTIQQYALKMVQDINAGKVTESTETYERMVT
RSLYGNINASRNSA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagattaccaaaaattgaacgttttaaaaatgaagtagaatctaagtaccagatt
ttcaatgggatttttatgaccctgccatttgatcagatttctaatactggcggattgtta
cccttgtttcatgaaatgtgtgtgaaaggctatgaaaaaggtaaaaaccccacagagatc
gttgaatacttttttgaaagatacatgcgtgataccagtcctaaagaacgagaagacatg
ctttttaggtttattcagtatatagaaagacaagtggtgttgtttgatgccattgaagat
gctgcttttagtaaagtcaacaatattgatgggcgtggttccttacgtagcgtcaaagag
gaagcagtggaacttaataaaacagaagaactggcagcttatttaaaagagtttaaagta
cgtcctgtattaaccgctcaccctacacagttttacccaggttctgttctgggaattatt
aatgatctgggcgatgcgattaaagctaatcaacttcaggaggtaaaactactgctttca
caattgggtaaaacccctttctttaaaaaggaaaaacctactccttttgatgaagcggta
agtttaatttggtatctggaacacgtattctatcaggccatgggtaatatttacgattac
cttaaaacacatattgagaatccgcaggagtttaagaatcagattgttgaaatagggttt
tggcctggtggtgatcgtgatggaaatccgtttgttacgactgctattactataaatgtg
gctaaacgattgcgttccaccatatttagaaattattatagggatttacgcaagctgcgt
agaagactcacttttaaaggcgttgaagagcagttagcggctctagaaagcatgtgttac
aaagctatttttgaaaaggatgtattggagtttgcacctcaagatcttatcgatagaatg
aacgagatcagatctactgttatagagcagcataactccttatttcttggtcaaatagat
agttttatacataaaatcgaattgttcggtttccattttgccactttagatatacgtcag
gatagcagtgctcatgatgcggtttttgatgagatcctcgctttcgcgaaagcgaaacta
cccaccaactacaacagcttatctgaagaagagaaagtgaacgtactggcacaggtagaa
ggttctatcgatcctaaagactttacagacgactacacacaacgcacgttaagcagtatt
tacgccattaaaaatatccaagaacgcaatggggaaaaaggttgtaatcgttacattatt
tctaatacacaaatggcttctcaaattatggaggtctatgcaatgataaggttgtgtaat
atgccacaacccaaaatagatgtagtgcccttatttgaaaccgttccagacctgataaaa
gctccagatgtgatgcgatcactttatgaaaatgagcattaccgagctcacgtaaaaaga
cgcgatgacacacaacatatcatgttgggctttagtgacggtactaaagatggtggctat
ttaatggccaattgggctatttatgaagctaaggaagcattaagtaccgtttctagggaa
tacggtatttctattgtattctttgatggtagaggtggcccacctgctcgtggtggaggt
caaacgcaccagttttatgcttctatgggaacaaaaatagaagctaaacacattcaatta
acagttcaaggccagactattagctctaagtttggtacgttagaaagctgccaatacaat
ctggagcaaatgattagtagtggggtgagtaacgccgtatacgctagtgatgccaatgac
ttttcagaaaaagataaagcaactatggatcaactggcaaaatcaagttatatagcttac
acagatttcaaagcgcacccacagttcttatcctatctggaacagatgagtaccttaaaa
tattatgccaaaaccaatataggaagtcgccctagcaagcgtgctggaagtgcagaattg
agatttaaagatttaagagctataccatttgtaggttcttggagtcaattaaaacagaat
gttcctgggttttacggtgtaggtaccgcgctagaaacaatggataaagctggtaattgg
gaagcggcagaagaactatataaaaacaataaatttttccgtactttactagataatagc
atgatgagtttaaccaagtcattctttgctttaactgcatatatggagcatgatcctatt
tatggtgagttttggaagatgatttatgcagaatatgagcgttctaaaaagtacatgttg
aagatctctggaatgaaaacattaatggaaaatgagccagcaggacgagcgagtattcaa
gctagagaaaagatagtcttgccattattaaccatacagcagtatgccttaaaaatggtt
caagatatcaatgcaggaaaggtgactgaaagtacagaaacctatgagcgcatggtcact
agatctctatatggaaatattaatgccagtcgtaattcagcatag

DBGET integrated database retrieval system