KEGG   Nitrosococcus oceani: Noc_0770Help
Entry
Noc_0770          CDS       T00281                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
noc  Nitrosococcus oceani
Pathway
noc00620  Pyruvate metabolism
noc00680  Methane metabolism
noc00710  Carbon fixation in photosynthetic organisms
noc01100  Metabolic pathways
noc01120  Microbial metabolism in diverse environments
noc01200  Carbon metabolism
Module
noc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Noc_0770
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Noc_0770
   00680 Methane metabolism
    Noc_0770
Enzymes [BR:noc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Noc_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ABA57283
UniProt: Q3JD13
LinkDB All DBs
Position
complement(838653..841526)
Genome map
AA seq 957 aa AA seqDB search
MTSMKPQTPETNPALQDQTGNTTPWRDKELRARVKLFGNLLGQVIQNQSGEKVFAAVEAL
RKGYINLRKKENSDKRIQLLRLIDTLNVEKITQVVRAFSIYFSLANIAEEAYQHRQRQRR
IDAGGPLWRGSFEETLRELRKSGISPEQLQIMLDNLAYIPVITAHPTEAKRRTVMEHLRK
IFLASKLLDETRLSQREEETLHRQLERQIQVLWKTDEVRAHRPQVQDEIINGLFYFKVSL
FQAVPETYRQLEEAINKVYGDMLPESTTLRVPSFLHFGSWIGGDRDGNPNVTPEVTAMAV
RLQMRMALQHYIACITKLTRILTHSIPLIRPSTALTESINQDLSDCPETFRGDPDRFSRE
PYRRKLYLMRYRLMDNLRAVERYLLPEIQPTPPQGVGYPSEEKFLEDLCLLRDSLSSHGD
GNIAAGELQDLIRLVESFGFYLLKLDVRQESGRHTEAVAELVKHLDLHPSYLDLSETERL
GLLSEQLAREEETTIQRERLTPATRETLDLFHVMAQMRQEVSPRVFGHYVISMTHAASHV
MEVMYLGYLAGLAGRRRGQWHCGLQISPLFETIEDLEHIEPVMTALLDDPSYRALLQAAG
NQQEVMIGYSDSCKDGGILASSWKLYDAQKKVTGLTDSRGVDCRIFHGRGGTIGRGGGPT
FDAILSQPQGTVHGQIKFTEQGEVLSSRYSNPETAIYELNMGISGLIKASTCLVQPPQEE
KRDYLGIIDSLVETGEQTYREFTEQTSGFQDYFYEATPVNEIGLLNIGSRPPHRKKGDRS
KNSVRAIPWVFGWAQARHTFPAWYGIGSALEKWRAGAPDRLAKLQTMYEEWPYFRALLSN
TQMSLAKAELHIAQQYAGLCLDPETGQKIFALLSAEYQRTVTQVLHIVGAHTLLEENPPL
ALSLQRRDPYLDPLNHIQLTLLKRTRDPRITPEEREAWLDPLLRSINAIAAGMRNTG
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgacatctatgaagccacaaactcctgaaaccaaccccgcgctccaagatcagacaggg
aataccactccctggcgggataaggaactgcgcgcccgcgtcaaactatttggcaatctc
ctaggccaggtcatccaaaaccagtccggggaaaaagtattcgccgctgtcgaggccttg
cgcaagggctatattaacctgcgcaaaaaagaaaattctgacaagcgaatccagttgctg
cgccttatcgacacgctgaatgtggagaagatcacccaggtcgtgcgggcctttagcatc
tactttagcctcgccaatattgccgaagaagcttaccagcaccggcaacggcaacgccgc
atcgatgcaggcggacctctttggcgaggctccttcgaagagactctacgagaactccgg
aagagcggaattagtcccgagcaactccagattatgctggataatctagcttatattccc
gtcattaccgcccatcccaccgaagccaagcgccgcacggtgatggaacatctccgcaaa
atcttccttgccagtaaacttctggacgagacgcgcctcagtcagcgggaggaagaaacc
ctccaccgccaattagaacggcaaatccaggtcctgtggaaaaccgatgaagttcgcgcc
caccggccccaggtccaggacgaaatcatcaacggcctattttatttcaaagttagcttg
ttccaggccgtacccgaaacctatcgccaactagaagaagccatcaacaaagtctatggc
gacatgctgcccgagagcaccactctccgggtccccagctttttacactttggctcctgg
attggcggagaccgggatggcaaccccaatgtcacgccggaagtcaccgccatggccgta
cggctgcaaatgcggatggccctacagcattatatcgcctgcattactaaattaacgcgc
attctcacccattccattcctctcatcaggccctcaacggccctgactgaaagcattaac
caagatttgagcgattgcccggagacctttcgaggcgatcccgaccgctttagccgcgaa
ccttaccggcgcaaactctacctgatgcgctaccgcctgatggataacttacgggccgtg
gaacgatatctcctgccagaaatccagcccaccccccctcaaggcgtcggttatccttcc
gaggaaaaatttcttgaggatctctgcctccttcgcgacagcctgagcagccatggtgac
ggcaacattgccgcaggggaattgcaagatctgattcgcctagtagaaagttttggcttt
tacctcctcaaactggatgttcgccaggaatcaggccgtcatacggaagcagtagcggaa
ttagtcaaacacctcgacctgcatcccagctatctcgatctttccgaaactgaacggcta
gggctcctttccgaacaactcgcccgcgaagaagaaaccaccatccagcgggagcggctt
acccccgctacccgggaaacactggatctctttcacgtcatggcgcaaatgcgccaagag
gtcagcccccgagttttcggtcattatgtgatttccatgacccatgccgccagtcatgtc
atggaggtcatgtatctaggctatcttgctggcctcgctggacgtcggcggggtcaatgg
cattgtggtctgcaaatctctcccctgtttgaaaccatcgaggatttagagcatatcgag
ccggtcatgaccgccctgcttgatgatcccagctatcgagccttactacaggccgccggc
aaccagcaagaagtcatgattggctactcagattcctgcaaggacggcggtatcctggct
tcctcctggaaactgtatgacgcccagaaaaaggtaaccgggctcaccgatagccggggg
gtggattgtcgtatcttccatggccggggcgggaccattggccggggcggtggcccaact
tttgacgctatcctgtcccaaccccaggggactgtccacggtcaaatcaagttcacggaa
cagggagaagtcctctcctcccgctacagtaaccccgagaccgcgatttatgaactcaac
atgggtatcagtggcctgattaaggccagcacctgcctcgtccaacctccccaggaagaa
aagcgtgattatctcggtatcatagactctttagtggaaacaggggagcagacttaccgg
gaattcacggaacaaacgtccggctttcaagattatttctatgaagccaccccggtcaat
gaaattggtctgttgaacattggctcccgccccccccaccggaaaaaaggagatcgttcc
aagaactcagtccgggctatcccctgggtctttggctgggcccaggcccggcatactttt
cccgcctggtatggtatcggcagcgccttggaaaaatggcgggctggcgcgcccgatcgg
ctcgcaaaactccaaaccatgtatgaagagtggccctatttccgtgccctgctcagcaat
acccaaatgtccctggccaaggccgagttgcatatcgctcagcaatatgccggcttgtgc
ctagatccagaaacgggacagaaaatctttgccctgctcagcgcggagtaccaacgcacg
gtcacccaggtgctccatatcgtgggggcccacaccctgctggaggagaaccctcccctg
gctctgtccttgcaacgccgggacccctacctggaccccctcaatcatatccaactcact
cttcttaaacgcacccgcgatccacgaatcactcccgaggagcgggaagcatggcttgat
cctctgctccgttctatcaatgccatcgcggctgggatgcgcaatacgggctga

DBGET integrated database retrieval system