KEGG   Nitrosococcus oceani: Noc_1317Help
Entry
Noc_1317          CDS       T00281                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
noc  Nitrosococcus oceani
Pathway
noc00440  Phosphonate and phosphinate metabolism
noc01100  Metabolic pathways
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:noc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Noc_1317
Enzymes [BR:noc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Noc_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 NTP_transferase ICL
Motif
Other DBs
NCBI-ProteinID: ABA57815
UniProt: Q3JBI1
LinkDB All DBs
Position
complement(1465505..1467175)
Genome map
AA seq 556 aa AA seqDB search
MSTVPLPTAGTFKRRPSKFAQLRALLKSEPTEFLLEAHNGLSARIAEEAGFKGVWASGLA
ISSQFGVRDNNEASWTQIVDMLEFMSDTTTIPILLDGDTGYGNFNNLRRLVRKLEQREIA
GVCIEDKVFPKTNSFIGGERQPLAEVDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGL
DEALRRAEAYHRAGADAILIHSKLSQADEILAFAREWGNRAPLIIVPTKYYSTPTEVFRK
AGISTVIWANHLIRAAAAAMAQVAREIHDTQTLVNIEDQVAPVSEIFRLQGAEELLAAER
RYGASPEAETGAIVLGATRGKGLESLTQDRPKVMLPVAGIPLLRRLVDEFKRQHVNRITV
VTGYKPEAIDVKAISLIHNPDYGHSSELSSLACALESLSEDTIITYGDLLFRSYILNDLR
HVPGNIVVVVDSALSPGMKDDIRDVAFCSQPDDRSLFRQDVDLLRIETQKKQLSKQPHGR
WIGMARVAGEGRQWLLDALQALRQQENFSQLAMPDLFNHLVANGHPIKVLYINGHWLDVN
DMEDLTRAGDFAHGHQ
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtacccttacccacggctggaacttttaaacgtcggccttcaaagtttgcc
caattacgggctttactgaaatccgaacccacagaatttctgctagaagcccacaatggc
cttagcgcccggattgccgaagaagccggatttaagggagtttgggccagtggtctggca
atttcttcccagtttggagtcagagacaataacgaggctagctggacccaaatagtggat
atgctagagtttatgtccgacaccaccactattcccattctcctggatggcgatacggga
tatggaaattttaataacttgcgccggctagtgagaaagctagagcagcgggaaattgcc
ggcgtttgtatcgaagataaagttttccctaaaactaacagttttattggcggtgaacgc
cagcctttagctgaagtggacgaattttgcggcaagatcaaggctgggaaagattctcaa
agtgatcccgatttctccatcgtggcacgagtcgaggctttaatcgcgggctgggggctg
gatgaagccttacgccgcgcagaagcttaccatcgggctggggcggatgccatattaatc
cacagtaaactttcccaagccgatgagatcctagccttcgccagagaatggggaaaccgg
gcaccactcattattgtccccactaaatactacagtacgcccaccgaagtattccgcaag
gcgggcatcagcaccgtcatttgggctaatcatttaattcgggccgctgcggccgcaatg
gctcaagtggcgcgggaaatccatgatacgcaaaccctagttaacatcgaggatcaggtt
gcaccggtcagtgaaattttccgcctccaaggggccgaggaattactggctgctgaacgc
cgttacggcgcttccccagaggccgagacgggagcgattgtgctgggggctacccggggc
aaaggactagaaagcctgactcaggatcgtcccaaagtcatgctgccggtggccggcatc
ccactgctacgccgcctagtagacgaatttaaacgacagcacgttaatcgcatcacggta
gtgactggttataaaccagaagccattgatgtcaaggctatttccctcattcataaccca
gattacggccatagcagtgagttatcttcccttgcctgtgcccttgagagcttatccgag
gataccatcatcacctatggcgacctgctgttccgcagctatatcctaaatgatttgcgc
cacgtgccaggaaacattgttgtcgttgtggattctgccctttctcctggcatgaaggat
gatatccgggatgtggctttctgctcccagccggatgaccgttccttgttccgccaggat
gtagacctccttcgtattgaaacgcaaaaaaagcagctcagtaaacagccccacggtcgc
tggatcggcatggcccgagtcgcgggtgaaggacgccaatggctgctcgatgccctccaa
gcattacggcaacaagagaatttttcccaacttgcaatgcccgatttattcaatcatctg
gtcgccaacggccacccaattaaggttctctacattaacggccattggctggatgtaaat
gacatggaggatctaacccgcgccggcgactttgcccacggtcatcaataa

DBGET integrated database retrieval system