KEGG   Nitrosococcus oceani: Noc_2471Help
Entry
Noc_2471          CDS       T00281                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
noc  Nitrosococcus oceani
Pathway
noc00020  Citrate cycle (TCA cycle)
noc00190  Oxidative phosphorylation
noc00650  Butanoate metabolism
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
Module
noc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
noc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
noc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:noc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Noc_2471
   00650 Butanoate metabolism
    Noc_2471
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Noc_2471
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Noc_2471
    1.3.5.4  fumarate reductase (quinol)
     Noc_2471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like NAD_binding_7 Thi4 GIDA
Motif
Other DBs
NCBI-ProteinID: ABA58924
UniProt: Q3J8C2
LinkDB All DBs
Position
complement(2815892..2817655)
Genome map
AA seq 587 aa AA seqDB search
MNLPRRRFDTLVIGAGGGGLRAALQLAEAEANVAVVSKVFPIRSHTVAAQGGMNAALANV
SPDSWHWHMYDTVKGSDYLGDQDAIEYMCRAAAHLVIDLEHAGVPFSRLENGKIYQRAFG
GQSQNFGGEQAARTCAAADRTGHAILHSLYQQNIKSKTHFFDEFFALDLIKDAEGYILGA
VVLEIETGQPWIIEAKCTLLATGGAGRLFRTNTNARINTGDGMAMALRAGIPLQDMEFVQ
FHPTGIAGKGMLITEGVRGEGGYLVNCEGERFMERYAPHVKDLASRDVVSRAIYTEVKEG
RGCGPDGDYVLLKLEHLGANIIKERLPGIRQTVLTFLHFDPIEQPIPVYPTCHYVMGGIP
TNRFGQVVAPYNEGAEEAIPGLYAVGECACVSVHGANRLGGNSLLDIVVFGRAAGNHIIE
HLEAHRYHRALASESVEQALERLARWERPGDGESVEELRADLQKFMEQNCGVFRNEAVLE
EAVHKVTEIEERLQYVRLKDQSKIFNTARLDALELENLVGLAQAVVRCALARQESRGAHY
RVDYPERDDIRWLKHSLYFQGQGHVEYKPVRLKPLTVDTFPPKERVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgccacggcgacgttttgatacgctggttattggtgctggtgggggaggactc
cgggcggctctacagttggccgaggcggaagccaatgtggccgtggtctctaaagtcttt
cctattcgttcccatactgtcgctgcccaagggggaatgaatgccgcgcttgccaatgtg
tcgccggatagctggcactggcatatgtacgatacagttaagggaagtgattatctgggg
gatcaggatgctatcgagtatatgtgtcgggccgctgctcatttagtgattgatctggaa
catgcgggggttccgttttcacggttggagaatgggaaaatctatcaacgggcttttgga
gggcaaagccagaattttgggggcgagcaagctgctcgaacttgtgccgcagctgatcgc
accggccatgccatccttcatagtctttatcagcaaaatatcaagtctaaaactcatttc
tttgatgagttttttgccctggatctgattaaagatgccgagggttatattttgggtgct
gtggtactggagatagaaacgggccagccctggattattgaagctaaatgtaccttatta
gccaccgggggagcagggcggcttttccgcactaatacaaatgcccgcatcaatacgggc
gatggtatggctatggctttgcgtgccgggattccgctgcaggatatggagtttgtccaa
tttcatcccaccggtatcgcgggcaagggaatgcttatcacagaaggagtacggggagaa
ggtggctatctggttaactgcgaaggggagcgtttcatggagcgttatgccccccatgtc
aaggatcttgcgagccgagatgtggttagccgtgctatttatactgaagtgaaggaagga
cgcggatgcggccccgacggtgattatgtcttgctcaaattggagcatttaggggcaaat
attatcaaggaacgtttaccgggcatccggcaaaccgttttgacttttttgcattttgac
cctatcgaacagcctattccggtctatcccacctgccattatgtgatgggaggtattcct
accaaccgtttcgggcaagtagtagctccctataatgagggagccgaagaggctatccct
ggattatatgcagtgggggaatgtgcttgtgtttccgtccatggggctaatcgcctgggg
gggaattcgttgctggatatagtggtattcgggcgtgccgcaggtaatcatattattgag
cacctggaagcacatcgctatcatcgggccttggcttccgagagtgtggagcaggctttg
gagcgtttagcccgctgggagcgtcctggtgatggggaaagtgtggaggaattacgcgct
gatctgcaaaaatttatggaacaaaattgtggcgtattccgcaatgaagccgtgcttgaa
gaggctgttcataaggtaacggagattgaggaacggttgcagtatgtacgtttgaaggac
cagagtaaaatttttaatactgcccggcttgacgcgttagaactggaaaatttagtgggg
ctagcacaagcggtagtccgttgcgcccttgcgcggcaggagagtcgaggcgcccattac
cgggtagattatccggaacgggatgatatccgttggcttaaacactccttgtatttccaa
ggacaagggcatgtggaatacaagccagtacgattaaagcctttgaccgtggataccttt
cctccaaaagaaagagtttactaa

DBGET integrated database retrieval system