KEGG   Nocardia otitidiscaviarum: FOH10_12880
Entry
FOH10_12880       CDS       T06114                                 

Definition
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
nod  Nocardia otitidiscaviarum
Pathway
nod00250  Alanine, aspartate and glutamate metabolism
nod00410  beta-Alanine metabolism
nod00640  Propanoate metabolism
nod00650  Butanoate metabolism
nod01100  Metabolic pathways
nod01120  Microbial metabolism in diverse environments
Module
nod_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FOH10_12880
   00650 Butanoate metabolism
    FOH10_12880
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FOH10_12880
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FOH10_12880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nod01007]
    FOH10_12880
Enzymes [BR:nod01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     FOH10_12880
Amino acid related enzymes [BR:nod01007]
 Aminotransferase (transaminase)
  Class III
   FOH10_12880
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: QDP79474
UniProt: A0A516NKP2
LinkDB
Position
2940820..2942061
AA seq 413 aa
MTALSPVLLQATPVTVDHGAGCYLYDTDGRRYLDFTAGIGVTSTGHCHPRVVEAAQAQVA
KLVHGQYTTVMHRPLLDLTEKLGEVLPEGLDSLFFANSGSEAVEAALRLARQSTGRPNII
VFHGGFHGRTVAAATMTTSGTRFSAGFSPLIGGVHVAPFPTAFRYGWSEEQATDFALREL
DYILATLTSPAETAAFVVEPVLGEGGYVPATAGFLQGLRERADRHGILLVLDEIQTGFGR
TGKFFGHQHFGIRPDIITIAKGLASGFPLSGIAAPAELMARAWPGSQGGTYGGNAVACAA
ALATLEVIEKEGLVENAALRGRELLDGVRARATSGIGDVRGLGLMVGAEFTTAAGEPDTA
TATEARRLAVEKGMLLLACGAHMNVVRMIPALVATAEQIREGLDIWEAVLAEL
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgactgccctgtcccccgtcctcctccaggccacccccgtcaccgtcgaccacggtgcg
ggctgctacctgtacgacaccgacggccgccgctacctggacttcaccgccgggatcggc
gtcaccagcaccggccactgtcatccgcgcgtggtggaggccgcgcaggcgcaggtggcg
aagctggtgcacggccagtacacgaccgtcatgcaccggccgctgctcgatctcaccgag
aagctcggtgaagtgctgccggaggggttggattcgctgttcttcgccaattccggcagt
gaggccgtcgaggcggctttacggttggcgcggcaatccaccgggcggccgaacatcatc
gtcttccacggcggtttccacggccgtaccgtcgccgccgccaccatgaccacctccggc
acccgtttctcggccggtttcagcccgctcataggcggggtgcacgtggcccccttcccc
accgcgttccgctacggctggagcgaggaacaggccaccgatttcgcgctgcgggaactg
gactacatcctggccaccctcacctccccggccgagaccgcggccttcgtcgtggaaccg
gtgctcggtgagggcggctacgtgcccgccaccgccggattcctgcagggtttgcgtgag
cgcgccgaccggcacgggattctgctggtgctcgacgagatccagaccgggttcgggcgc
accggaaagttcttcgggcatcagcacttcggtatccggcccgacatcatcaccatcgcc
aaggggttggccagcggcttcccgctctcgggtatcgcggctccggccgagctcatggcg
cgggcctggcccggttcgcagggcggcacctacggcgggaacgcggtggcgtgcgcggcc
gccctggccaccctcgaggtgatcgagaaggagggtctggtcgagaacgcggcgctgcgt
ggtcgtgaactgctcgacggggtgcgggcccgcgccacctccggcatcggcgacgtgcgc
ggtctcggcctcatggtgggtgccgaattcactacggccgcaggggaacccgatacggcc
acggccaccgaggcgcggcggctggcggtggagaagggcatgctgctgctggcgtgcggc
gcgcacatgaacgtggtgcgcatgatcccggcgctggtcgcgaccgccgaacagatccgc
gagggcctcgacatctgggaggcggtgctcgccgagctgtga

DBGET integrated database retrieval system