KEGG   Nocardia otitidiscaviarum: FOH10_21940Help
Entry
FOH10_21940       CDS       T06114                                 

Definition
(GenBank) hypothetical protein
Organism
nod  Nocardia otitidiscaviarum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: QDP80981
UniProt: A0A516NPZ5
LinkDB All DBs
Position
4896007..4896834
Genome map
AA seq 275 aa AA seqDB search
MAAVLALSACSSQPTLVPETTGATPTAVKPTTGLVAALPGSLAWDFNELQATLQGTVGLA
VMAVGGDRQVTLGDWSTGVAWSTIKVPLTLAALRNNPGYSGAASAAITASDNSSAEMLWQ
SLGSADTAAQAVEAVLREGGDATTTVPARPPRSEYSAFGQAEWSLSDQLRFASRLPCLPQ
ADTVTALMGKVSSGQRWGLGTLEGARFKGGWGPDTGGDYLVRQFGLLPVTGGDIAIALAA
APDSGSFDDGAALLTKLAGLIELHLEELAGGGCPP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccgtgctggcgctgtccgcctgtagcagccagcccacgctggtgcccgaaacc
accggtgccacaccgacggccgtcaagcccaccaccggactcgttgccgcccttcccggt
tcgctggcctgggatttcaacgaattgcaggccacgttgcagggcacggtgggactggcg
gtcatggccgtgggcggtgaccggcaggtcaccctcggcgactggagcaccggtgtggcc
tggtcgaccatcaaggtgccgctgaccctggccgcgctgcgcaacaatccggggtacagc
ggcgcggccagcgcggcgatcacggcctccgacaactcctccgccgagatgctctggcag
tcgctcggatcagcggatacggccgcgcaggcggtggaggccgtgctgcgcgagggtggt
gatgcgaccaccaccgtgcccgcccggccgccacgctcggagtactcggccttcgggcag
gccgaatggtcgctgtcggatcagttgcgcttcgcctcccggctgccctgcctgccgcag
gccgatacggtcaccgcgctcatggggaaggtcagctccggccagcgctgggggctgggc
accctggagggcgcgcggttcaagggcggctggggtcccgacaccggcggcgactatctg
gtgcgtcagttcgggctgctcccggtgaccggcggggacatcgccatcgcgcttgcggcc
gcgcccgattcgggttccttcgacgacggcgccgccctgctcaccaagctcgcggggctg
atcgaactgcatctcgaggaactcgccggaggcggctgcccgccgtag

DBGET integrated database retrieval system