KEGG   Nocardia otitidiscaviarum: FOH10_33470
Entry
FOH10_33470       CDS       T06114                                 

Gene name
thiS
Definition
(GenBank) sulfur carrier protein ThiS
  KO
K03154  sulfur carrier protein
Organism
nod  Nocardia otitidiscaviarum
Pathway
nod04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:nod00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    FOH10_33470 (thiS)
SSDB
Motif
Pfam: ThiS
Other DBs
NCBI-ProteinID: QDP82906
UniProt: A0A378Y9M9
LinkDB
Position
7439127..7439339
AA seq 70 aa
MTAIPIGITVNGEDHTFPEPISVRALLDTLNLPCQGVAVAVDGALFPKSRWDEPVGRGWE
IEVLTAVQGG
NT seq 213 nt   +upstreamnt  +downstreamnt
atgaccgctattcccatcggcatcaccgtgaacggtgaggatcacaccttcccggaaccg
atttcggtacgcgccctgctggacacgctgaatctgccctgccagggcgtcgccgtcgcg
gtggacggcgcgctgttccccaaatcccgctgggacgagccggtcggtcgcggctgggag
atcgaggtgctgacggcggtgcagggtggctag

DBGET integrated database retrieval system