KEGG   Nostoc sp. CENA543: CLI64_09625Help
Entry
CLI64_09625       CDS       T05285                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
noe  Nostoc sp. CENA543
Brite
Enzymes [BR:noe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLI64_09625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: AUT00631
UniProt: A0A2I8A5I4
LinkDB All DBs
Position
complement(2326147..2326749)
Genome map
AA seq 200 aa AA seqDB search
MAFTQPPLPFDSNALEPYGMKAETFEYHYGKHHKAYVDNLNKLTEGTDLADKSLEEVIQI
SFKDPSKAGIFNNAAQVWNHTFFWNSLKPAGGGAPTGDLAAKIDRDFGSFDKFKEEFSNA
AATQFGSGWAWLIDDGGTLKVMKTPNAENPLAHGKKALLTIDVWEHAYYIDFRNARPAFI
KNFLDQLVNWDFVAENLAKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattcactcaaccccccttacctttcgactctaatgctttagaaccatatggtatg
aaagctgaaaccttcgagtatcactatggtaagcatcacaaagcttatgtagataacctc
aacaagctgaccgaaggtacagacttagctgataaatccctagaagaagtcatccaaatt
tcctttaaagacccctccaaagctgggattttcaacaacgccgcacaagtttggaatcac
accttcttctggaattccttaaaacccgcaggtggtggcgcacctaccggcgacttagct
gctaaaattgacagagattttggtagcttcgacaaattcaaagaagaattttctaatgcg
gctgcaactcaatttggtagtggctgggcttggttgattgacgatggtggtacactcaaa
gtaatgaaaacaccaaatgcagagaaccctctagctcatggtaaaaaagcactgctcacc
atagatgtttgggaacacgcctactacattgattttagaaatgctcgtccagcatttatt
aaaaacttcttagatcaactggtaaactgggactttgttgcagaaaacttagctaaagct
taa

DBGET integrated database retrieval system