KEGG   Nostoc sp. CENA543: CLI64_11695
Entry
CLI64_11695       CDS       T05285                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00010  Glycolysis / Gluconeogenesis
noe00020  Citrate cycle (TCA cycle)
noe00620  Pyruvate metabolism
noe01100  Metabolic pathways
noe01110  Biosynthesis of secondary metabolites
noe01120  Microbial metabolism in diverse environments
noe01200  Carbon metabolism
Module
noe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI64_11695
   00020 Citrate cycle (TCA cycle)
    CLI64_11695
   00620 Pyruvate metabolism
    CLI64_11695
Enzymes [BR:noe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CLI64_11695
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase DEC-1_N MadL GCV_H
Other DBs
NCBI-ProteinID: AUT01008
UniProt: A0A2I8A6L5
LinkDB
Position
2837753..2839051
AA seq 432 aa
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
VVQAGDSAPVGAAIAYVAETEAEIEAAKSMGNSGAAAAATPTPEPIPATALVGATTTASQ
NGSNHKEGRLVASPRARKLAKELKVDLNSLKGSGPYGRIVAGDVESAVGKTPAPVAPVAP
VTPAPSITPVAPAAPAPRTPAPAPVAAVPGQIAPFNTLQNAVIRNMVASLAVPEFRVGYT
ITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGVVYHSDINISVAVA
MDDGGLITPVLKNADQVDIYSLSRNWKSLVDRARAKQLQPDEYNSGTFTVSNLGMFGVDT
FDAILPPGQGSILAVGASRPQVVASPDGLFAVRQQMQVNITCDHRIIYGAHAAAFLQDLA
KLIETDAQSLTL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcattcacgaaatattcatgccagccctgagttccaccatgacggaaggtaaaatt
gtttcctgggtcaaatcgccaggggataaagtggaaaaaggcgaaacagtggtggttgtg
gagtcagataaggcagatatggatgtagaaaccttctatgaagggtatctcgcacatatc
gtagtgcaagccggtgacagtgcgcctgtaggagctgcgatcgcttatgtggctgaaact
gaagcggaaattgaagctgctaaatctatgggtaattccggtgcggcggctgcggctact
cccacccccgaaccaattcctgctacagccttagttggtgcaaccactacagcatctcaa
aacggttctaaccacaaagaaggtagacttgtagcatcacccagagcgcggaagttagcc
aaagaattaaaagtagatttaaacagcctcaaaggtagcggcccctacggtcggattgtc
gctggtgatgtcgaatctgccgttggtaaaactcctgcaccagttgcaccagttgcacca
gtcactcccgcacccagcattaccccagttgcaccagcagcacccgcaccccgcacaccc
gcacctgcaccagttgcagccgttcctggtcaaatcgccccattcaatactctgcaaaat
gccgtcattcggaatatggttgctagcctagcagtaccagaattccgtgtgggttacaca
atcaccactgatggattagacaaactttacaaacaaattaaatcgaagggtgtcaccatg
acagccctactggcgaaagcagtcgcagtgacattacaaaaacacccacttttaaatgct
agttattcagatcaaggtgttgtttaccactccgacatcaatatttctgtagctgtcgca
atggatgatggcggtttaattacacccgtattaaaaaatgctgatcaagtagacatttac
tcactctcacgcaactggaaatctctagtagaccgcgctagagctaaacaactccaacca
gatgaatacaacagtggcactttcaccgtgtccaacttaggaatgttcggtgtagataca
tttgatgccattttacccccaggacaaggttcaatcttagcggttggtgcatcccgtccc
caagttgtcgctagtccagacggcttgtttgcagtccgtcaacaaatgcaggtcaatatc
acttgtgaccaccgcattatttacggcgcacacgcagccgcattcctacaagatttagcc
aagttgattgaaaccgacgctcaatctttgactctctaa

DBGET integrated database retrieval system