KEGG   Nostoc sp. CENA543: CLI64_11695Help
Entry
CLI64_11695       CDS       T05285                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00010  Glycolysis / Gluconeogenesis
noe00020  Citrate cycle (TCA cycle)
noe00620  Pyruvate metabolism
noe01100  Metabolic pathways
noe01110  Biosynthesis of secondary metabolites
noe01120  Microbial metabolism in diverse environments
noe01130  Biosynthesis of antibiotics
noe01200  Carbon metabolism
Module
noe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI64_11695
   00020 Citrate cycle (TCA cycle)
    CLI64_11695
   00620 Pyruvate metabolism
    CLI64_11695
Enzymes [BR:noe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CLI64_11695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase DEC-1_N MadL GCV_H
Motif
Other DBs
NCBI-ProteinID: AUT01008
UniProt: A0A2I8A6L5
LinkDB All DBs
Position
2837753..2839051
Genome map
AA seq 432 aa AA seqDB search
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
VVQAGDSAPVGAAIAYVAETEAEIEAAKSMGNSGAAAAATPTPEPIPATALVGATTTASQ
NGSNHKEGRLVASPRARKLAKELKVDLNSLKGSGPYGRIVAGDVESAVGKTPAPVAPVAP
VTPAPSITPVAPAAPAPRTPAPAPVAAVPGQIAPFNTLQNAVIRNMVASLAVPEFRVGYT
ITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGVVYHSDINISVAVA
MDDGGLITPVLKNADQVDIYSLSRNWKSLVDRARAKQLQPDEYNSGTFTVSNLGMFGVDT
FDAILPPGQGSILAVGASRPQVVASPDGLFAVRQQMQVNITCDHRIIYGAHAAAFLQDLA
KLIETDAQSLTL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcacgaaatattcatgccagccctgagttccaccatgacggaaggtaaaatt
gtttcctgggtcaaatcgccaggggataaagtggaaaaaggcgaaacagtggtggttgtg
gagtcagataaggcagatatggatgtagaaaccttctatgaagggtatctcgcacatatc
gtagtgcaagccggtgacagtgcgcctgtaggagctgcgatcgcttatgtggctgaaact
gaagcggaaattgaagctgctaaatctatgggtaattccggtgcggcggctgcggctact
cccacccccgaaccaattcctgctacagccttagttggtgcaaccactacagcatctcaa
aacggttctaaccacaaagaaggtagacttgtagcatcacccagagcgcggaagttagcc
aaagaattaaaagtagatttaaacagcctcaaaggtagcggcccctacggtcggattgtc
gctggtgatgtcgaatctgccgttggtaaaactcctgcaccagttgcaccagttgcacca
gtcactcccgcacccagcattaccccagttgcaccagcagcacccgcaccccgcacaccc
gcacctgcaccagttgcagccgttcctggtcaaatcgccccattcaatactctgcaaaat
gccgtcattcggaatatggttgctagcctagcagtaccagaattccgtgtgggttacaca
atcaccactgatggattagacaaactttacaaacaaattaaatcgaagggtgtcaccatg
acagccctactggcgaaagcagtcgcagtgacattacaaaaacacccacttttaaatgct
agttattcagatcaaggtgttgtttaccactccgacatcaatatttctgtagctgtcgca
atggatgatggcggtttaattacacccgtattaaaaaatgctgatcaagtagacatttac
tcactctcacgcaactggaaatctctagtagaccgcgctagagctaaacaactccaacca
gatgaatacaacagtggcactttcaccgtgtccaacttaggaatgttcggtgtagataca
tttgatgccattttacccccaggacaaggttcaatcttagcggttggtgcatcccgtccc
caagttgtcgctagtccagacggcttgtttgcagtccgtcaacaaatgcaggtcaatatc
acttgtgaccaccgcattatttacggcgcacacgcagccgcattcctacaagatttagcc
aagttgattgaaaccgacgctcaatctttgactctctaa

DBGET integrated database retrieval system