KEGG   Nostoc sp. CENA543: CLI64_11970Help
Entry
CLI64_11970       CDS       T05285                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00500  Starch and sucrose metabolism
noe01100  Metabolic pathways
noe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLI64_11970
Enzymes [BR:noe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     CLI64_11970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Glyoxalase_4
Motif
Other DBs
NCBI-ProteinID: AUT01060
UniProt: A0A2I8A6S6
LinkDB All DBs
Position
2922645..2925209
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPPRLEPMRKLAYNLHWDWNVETKDLFRRLDPDLWESSHHNPVLMLGT
ISQARLLEVVEDEGFLAQMDRAARQLEDYVQERTWYQKQRSQKPKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNVDGWQQERYPINDFYNM
PLHLERNPDGSELRIAVDYPGRKVYARVWRVQVGTVPLYMLDTNIEPNNPYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYEVTAYHMNEGHAAFSALERIRTLIQEQGLSYAE
AKQVVMSSNIFTTHTPVPAGIDLFPPDKILHYLGYYADIFDLPKEQFLGLGRENTGDLSA
PFSMAVLALKMATASNGVAQLHGVVSRQMFQGLWKKVPVDEVPITAITNGVHARSCVAKS
TQELYDRYLGPNWSSTPPDSPMWEKMEAIPDEELWRNHERCRLDMILYVRDHLVKHLRDR
GASPSEIAQAQEVLDPNVLTIGFARRFATYKRATLWMRDIERIKRILLGNKGRKVQFVIA
GKAHPKDIPGKELIRDINHFIREQHLEKQIVFVPNYDIHISRLMVAGCDVWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGENYEDPNYQDEVEANALYDLL
EKEVVPLFYDHRDDDGLPRPWVAKMKDAIRLNCPFFNTARMVREYAERAYFPASDRYHTL
KSDQYAPAKELAAWKAKLGDHWFNIRVKDIDVSASADIEVNQTVGVKAKVDLATLSNEDV
QVELYQGAIDANGEIVNAVPVVMDYQGQDTNGLGVYTADIVYTTSGLQGLSLRVLPKHPH
LSSLYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgattcgcacattcaacgtttctccttcactaccgccaagactagaaccaatg
cggaagttggcttacaacttacactgggattggaatgttgagactaaagatttatttcgc
cgcttagacccggatttatgggaatctagccaccataacccagtattgatgttaggtaca
atcagccaagcgcggcttttggaagtggtcgaagatgaaggcttcctggcgcaaatggat
cgtgccgcccgtcaattagaagattatgtgcaggaacgcacttggtatcagaaacagcgc
agtcagaagccaaaggaatgttacgcctatttttcggctgagtttggattggtagattgt
ctaccggtatattctggaggcttgggggtactggcgggggatcacctcaaatctgccagt
gacttgggcttaccacttgtgggagtgggtttactgtatcagcaaggctactttgcccag
tatctcaatgtggatggctggcagcaagaacgttatccgattaacgatttctacaatatg
cccttgcacctagaacgcaatcccgacggttcagaactgcggattgccgtagattatcca
gggcggaaggtctacgccagggtgtggcgcgtacaggtgggaacagtccctctgtatatg
ctagataccaacattgaacccaataacccttacgaccacgacatcacagatcagttgtat
ggtggcgatattgatatgcgtatccaccaagaaatcatgctggggattggtggtgtgcag
atgttgaaggcgttgggctatgaagtcaccgcttatcacatgaatgaaggtcacgccgcc
ttctctgccctagaacgcattcggacattaattcaagaacagggattaagttacgccgaa
gctaaacaggtggtgatgtccagtaatattttcaccacccatacaccagtgccggcgggg
attgatttgttccctcccgataagattttgcattacttgggctactacgcagatattttt
gatctccccaaagagcaatttttaggtctgggaagagaaaatacaggcgatttatctgca
ccctttagtatggcagtgctggctttaaagatggctacggcttctaatggtgttgcccaa
ctacacggcgtagtttcccgtcagatgttccaagggttatggaaaaaagtccctgtagac
gaagtaccaattaccgccattactaacggtgttcatgcccgcagttgtgtagcgaaatcc
actcaagagttatacgatcgctatctaggccccaattggtcatcaacaccaccagatagc
cccatgtgggagaaaatggaagcaattcccgatgaggagttgtggcgtaatcacgagcgt
tgccgcttggatatgattttgtatgtacgggatcatttagtcaagcatctacgcgatcgc
ggtgcgtctccctcggaaattgcccaagcccaagaagttctcgaccccaatgttttaacc
attggttttgcccggcggtttgctacctacaaacgcgctaccctgtggatgcgtgacatt
gaacggattaagcgcattttactaggtaacaaaggccgtaaggtgcaattcgtcattgct
gggaaggcacacccgaaagatattcccggtaaagaactcatccgcgacatcaatcacttt
atccgcgaacaacacctagaaaaacaaatcgtgtttgttcccaactatgacattcacatt
tcccgcttgatggtagctggttgtgatgtctggttaaatactccccgtcgtccccgtgaa
gcctccggtactagtgggatgaaagccgctatgaatggcttacctaatttgagtgtgcta
gatggttggtgggatgaagccgactatgtacgtacaggttgggcaattggtcacggcgaa
aactacgaagatcccaactatcaagatgaagtagaagccaacgccctctatgatttattg
gaaaaagaggtagtacccttattctatgaccatcgcgatgatgatggcttaccccgtcct
tgggtagccaaaatgaaagacgcgattcgcttgaattgtcctttctttaatacagcgcgc
atggtgcgagaatacgctgaacgggcatatttcccagctagcgatcgctaccacacctta
aaatctgatcaatatgctccagctaaggaattagcagcttggaaagcaaaacttggtgat
cattggtttaacatcagagtcaaagatattgatgtatctgcaagtgcagatatagaagtt
aatcaaactgtgggtgtaaaagcaaaagttgacctggccactttaagcaatgaagatgtg
caagtagaactatatcaaggcgcaattgatgccaacggtgagatagttaacgctgtccct
gtcgttatggattaccaaggacaggatacaaacggcttaggtgtttacactgctgatatc
gtttacaccacctctggtttacaaggtttgtctttacgggtattacccaaacacccacac
ctgtctagcctttatgaaccaagattgattgcttgggcggagtaa

DBGET integrated database retrieval system