KEGG   Nostoc sp. CENA543: CLI64_13470Help
Entry
CLI64_13470       CDS       T05285                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00010  Glycolysis / Gluconeogenesis
noe00053  Ascorbate and aldarate metabolism
noe00071  Fatty acid degradation
noe00280  Valine, leucine and isoleucine degradation
noe00310  Lysine degradation
noe00330  Arginine and proline metabolism
noe00340  Histidine metabolism
noe00380  Tryptophan metabolism
noe00410  beta-Alanine metabolism
noe00561  Glycerolipid metabolism
noe00620  Pyruvate metabolism
noe00625  Chloroalkane and chloroalkene degradation
noe01100  Metabolic pathways
noe01110  Biosynthesis of secondary metabolites
noe01120  Microbial metabolism in diverse environments
noe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI64_13470
   00053 Ascorbate and aldarate metabolism
    CLI64_13470
   00620 Pyruvate metabolism
    CLI64_13470
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLI64_13470
   00561 Glycerolipid metabolism
    CLI64_13470
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLI64_13470
   00310 Lysine degradation
    CLI64_13470
   00330 Arginine and proline metabolism
    CLI64_13470
   00340 Histidine metabolism
    CLI64_13470
   00380 Tryptophan metabolism
    CLI64_13470
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLI64_13470
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CLI64_13470
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLI64_13470
Enzymes [BR:noe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CLI64_13470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AUT01327
UniProt: A0A2I8A7I0
LinkDB All DBs
Position
3286401..3287870
Genome map
AA seq 489 aa AA seqDB search
MVTAQEPKQQVKIGATRLLINNEWVDSVSGRRFETINPTTGEVICEVAEADTPDVDKAVK
AARQAFNNGEWSKLSATRRGELLYKLADLIADNIDELARLETLDNGKPLRDSVEDLELAI
ACYRYYAGWADKVQGKTIPISGPYFCYTRHEPVGVVGQIIPWNFPIVMQAWKLAPALATG
NTVVLKTAEQTPLSALRVGELIVEAGFPPGVVNILSGYGPTAGAAIAHHMDVDKVAFTGS
TEVGHLIMEAAAKSNLKRVTLELGGKSPNIVFADADLDAAIEGAHDAIFFNQGQCCCAGS
RLFVEAKCYDEFVAKTVEKAKNRIVGDPFDSNTQQGPQVDKDQFDRVMSYIESGMREGAQ
MLCGGNRVGDRGFFIAPTVFADVRDEMQIAQEEIFGPVMSIIKFQDIDEVIQRANNTIYG
LAAAVWTKDITKAHAIANNVRAGTVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLQQYT
EVKTVTIKL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggttacagcacaagaaccaaaacaacaggtaaaaattggcgcaactcggctgctaatt
aataatgagtgggtggatagtgttagcggtcgtagatttgagacaattaacccaaccaca
ggtgaagtcatctgtgaagtagcagaagcagacacaccagatgtagacaaagccgtaaaa
gcagcgcgtcaggcttttaataatggagaatggtcgaaactatcagcgactcgtcgggga
gagttgctttataagttagctgatttaatagcagacaatattgatgaattggcgcgctta
gaaaccctagacaacggtaaaccactgcgtgattctgtagaagatttagaattagcgatc
gcctgctatcgttattatgcaggttgggcagataaggtacaaggtaaaaccatccccatt
agtggcccttacttctgctacactcgccatgagcctgtgggcgtagttggtcaaattatt
ccgtggaattttcctatagtcatgcaagcgtggaaattagccccagctttggctacaggt
aataccgtagttctcaagacggctgaacaaacaccattatcagcattgcgtgtgggagag
ttaattgttgaagcaggttttccccctggtgtagtgaacatattatcaggatatggcccg
actgctggagctgcgatcgctcatcacatggatgtggataaagtcgcctttactggttct
actgaggtgggacatttaattatggaagcggcggctaaaagcaaccttaagcgtgtcact
ctagaactaggcggaaagagtcccaacattgtctttgctgacgctgatttagacgctgcc
attgaaggcgcacacgatgccatattctttaatcaaggtcaatgttgctgtgctggttca
cggctatttgtagaagcaaaatgttatgacgagtttgtcgctaaaaccgtagaaaaagcc
aaaaatagaattgtcggcgatccttttgatagtaatacacaacaagggccgcaagtagac
aaagaccaattcgacagagtcatgagttacatcgaatcgggaatgcgagaaggggcgcag
atgttatgcggcggcaaccgtgtcggagataggggtttctttattgcacccaccgtattt
gctgatgtccgtgatgagatgcaaattgctcaagaggaaatctttggcccggtgatgagt
attatcaaattccaagatatcgacgaagtgattcaacgggcaaataacaccatatacgga
ctcgccgccgccgtatggacgaaagatattaccaaagctcatgcgatcgcgaataacgtc
cgggctggtacagtatgggtaaattgctacgacgtatttgatgcagccgcaccctttggt
ggctttaaacaatcaggtattgggcgtgaactcggtgaatatggcttacaacagtacacc
gaagttaagactgttactatcaagttgtag

DBGET integrated database retrieval system