KEGG   Nostoc sp. CENA543: CLI64_15855Help
Entry
CLI64_15855       CDS       T05285                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLI64_15855
Enzymes [BR:noe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CLI64_15855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUT01741
UniProt: A0A2I8A8Q8
LinkDB All DBs
Position
3861322..3862815
Genome map
AA seq 497 aa AA seqDB search
MINPLNCQNYINGQWLSATEENILASHNPANKTEVVATFPRSQVEDVDLAVAAAREAYQS
WRKVPAPARAEYIFRVGELLAEHKEELAQLISREMGKPLTEARGDVQEGIDCAFYSAGEG
RRLFGQTTPSEMPNKFAMTVRMPIGVCALITPWNFPVAIPCWKAMPALVCGNTVILKPAE
DTPACATKLVEIFAAAGLPPGVINLLHGVGEEVGKALVEHPDIDLVSFTGSSETGAYVGA
TCGRTHKRVCLEMGGKNAQVVMEDADLELALDGAVWGAFGTTGQRCTATSRLILHRDIKE
KFTSMLCERAEKLRLGAGDQPETEIGPIINHRQLQRVSDYMKIAREEGAEILIGGEIATE
GDLKAGYFFQPTVLDHVTPQMRVAREEIFGPVVALIEVSTFEEAIAILNDTKYGLSSSVY
TRDINRAFTAMRDIAAGITYINGPTIGAEVHLPFGGVKQTGNGHREAGTTALDVFTEWKS
VYVDFSGSLQRAQIDNR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgataaatccgctaaattgccaaaattatattaacggtcagtggttgagtgctaccgag
gaaaatatcctagctagtcataaccctgctaataaaactgaagttgtcgcaactttcccc
cgttctcaagtggaggatgtagatttagctgtggctgctgctagagaagcttatcaaagt
tggcgaaaagtccccgccccagctagagccgaatacatctttcgtgtaggagaattgtta
gctgaacataaggaagaactagcacagttaattagtcgggagatgggtaaaccattaact
gaggctaggggtgatgtacaagaagggattgactgtgctttttatagtgctggggaagga
aggcgactgtttggacaaacgacaccttcggaaatgcccaataagttcgctatgacggtg
agaatgcccattggggtttgtgctttaattacaccgtggaatttccctgtagctattccc
tgttggaaagcaatgccggctttagtatgtggaaatacagtcattctcaaaccggcggaa
gatacgccggcttgtgcaactaaattagtagaaattttcgccgccgcaggtttaccacca
ggagtaattaacttattacatggggtgggggaagaagtaggaaaagctttagttgaacac
ccagacattgatttagtgtcctttaccggttcttcggaaacaggtgcttatgtaggtgca
acttgtggacggactcacaaacgcgtctgtttagaaatgggtggtaaaaatgcccaagtt
gtcatggaagatgcagacttagaattggctttggatggtgctgtttggggtgcattcggc
acaactggacaacgttgtacggctactagtcgtttgattttacaccgcgatatcaaagaa
aaatttacgagtatgctgtgtgaacgtgccgaaaagttacgtttgggtgctggtgatcag
ccagagacagaaatcggcccgataattaaccacagacaattgcaacgggtcagtgattat
atgaaaattgcccgtgaggaaggtgcagaaatattaattggtggggaaattgctactgag
ggtgatttaaaagcgggttacttttttcagccgacggttttagatcatgtcacacctcaa
atgcgggtggcgcgagaagagatatttggccctgtggtggcgttaattgaggtgagtacc
tttgaagaagcgatcgccattttaaatgataccaaatatggtctttcttcttcagtctat
actcgcgacatcaaccgcgcctttactgctatgcgcgacattgcagcaggtattacttac
attaatggccctaccattggcgcagaagtacatttaccttttggtggtgtcaaacaaaca
ggtaacggacacagagaagcgggaacgactgccttagatgtttttactgagtggaaaagt
gtttatgttgacttttctggcagtttacaacgcgctcaaattgataatcgttag

DBGET integrated database retrieval system