KEGG   Nostoc sp. CENA543: CLI64_17985Help
Entry
CLI64_17985       CDS       T05285                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CLI64_17985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:noe02000]
    CLI64_17985
Enzymes [BR:noe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CLI64_17985
Transporters [BR:noe02000]
 Other Transporters
  Pores ion channels [TC:1]
   CLI64_17985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AUT02121
UniProt: A0A2I8A9W3
LinkDB All DBs
Position
4389351..4390016
Genome map
AA seq 221 aa AA seqDB search
MSNIQLYFAKASTFSQRTRVVLLEKGIDFTPIEIDLQNKPEGYTQISRYGKVPAIQHGDV
VIYESAIINEYLEEVFPEPALLPHEPAKKAIARIWIDYANTRLVPAFNKFLRGKDSQERE
QGRQEFTEALLYLEQEGLGKGDYFLGDQFSLVDISFYPWFERLPLLEHFRQFALPAETPR
LQTWWNLVRDRHSIQGVANPVDFYLQRFAKILGEPVPVGAK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatccaactttactttgctaaagcttctactttctcacaacgtacccgtgta
gttttactagaaaaaggtattgactttaccccgatagagattgatttacagaataaacca
gagggttacacgcagatttcccgctatggtaaagttccagcgattcaacatggggatgtt
gtgatctatgaatctgcaattattaatgagtatttagaggaagtgtttcccgaaccagca
ttattaccccatgagccggcaaaaaaagcgatcgctcgcatctggatagactacgccaat
actcgccttgtcccagcttttaacaaatttctccgtggtaaagatagtcaagaacgggaa
cagggaagacaagagttcacagaagcacttttatatttggaacaagaaggattaggtaaa
ggtgattatttcttgggtgatcagtttagtctcgttgatattagtttttatccctggttt
gaacgtttaccactcttggaacatttccgtcaatttgcactaccagcagaaacaccacgt
ttgcagacatggtggaatctggtgcgcgatcgccactcaattcaaggagtagcaaatcct
gtagacttctatttacaaagatttgccaaaattttaggtgaacctgttcccgttggtgca
aagtaa

DBGET integrated database retrieval system