KEGG   Noviherbaspirillum sp. UKPF54: FAY22_18320Help
Entry
FAY22_18320       CDS       T06116                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
nok  Noviherbaspirillum sp. UKPF54
Brite
KEGG Orthology (KO) [BR:nok00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FAY22_18320 (ahpF)
Enzymes [BR:nok01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FAY22_18320 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin NAD_binding_7 FAD_binding_3 DAO K_oxygenase NAD_binding_8 Thi4 FMO-like AlaDh_PNT_C NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: QDZ29748
UniProt: A0A5B8NBH3
LinkDB All DBs
Position
complement(3963168..3964745)
Genome map
AA seq 525 aa AA seqDB search
MLDDTLKTQLKAYLDKITHPIEIIATLDDSDASRDMAALLRDIDALSDSITLATGGKDER
APSFSLNRVGANISIRFAGIPMGHEFTSLVLALLQTGGHPPKVDADVLDHIRNLPGEYRF
ETYISLSCQNCPEVVQALNLMAVVNPNISHVMIDGALFQDEVAKRQIMAVPTVFLNGETF
GQGRMSIEEIVAKLDSGAAQREADKLAQKDVFDMLVVGGGPAGAAAAIYSARKGIRTGVV
AERFGGQVLDTMGIENFISVKETEGPKLAAALEQHVKSYDVDVMNMQRAAALVPGDLIEV
KLAGGASLKAKTVVLATGARWRELNVPGEQQYRNRGVAYCPHCDGPLFKGKRVAVVGGGN
SGVEAAIDLAGIVAHVTLLEYDSQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDGSKVN
GMRYTDRNSGESKHVELEGIFVQIGLLPNTDWLKGTVALSNRGEIEVDAHGRTSVPGVFA
AGDATTVPYKQIVIAMGEGSKAALSAFDHLIRTSAPAEEKAAIAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgataccctcaagacccaactgaaagcctacctcgacaagatcacccatccg
atcgagatcatcgcgacgctggacgacagcgacgcctcgcgcgacatggccgcgctcctg
cgcgacatcgacgcgctgtcggacagcatcacgctggccaccggcggcaaggacgagcgc
gcgccgtcgttttcgctgaaccgcgtcggcgccaatatcagcatccgtttcgccggcatc
ccgatggggcacgagttcacctcgctggtgctggcgctgttgcagaccggcggccatccg
ccgaaggtcgacgccgacgtgctcgaccatatccgcaacctgccgggcgaataccgcttc
gagacctatatctcgctgtcgtgccagaactgcccggaagtggtgcaggcgctgaacctg
atggcggtggtcaatcccaacatcagccatgtgatgatcgacggcgccctgttccaggat
gaagtcgccaagcgccagatcatggccgtgccgaccgtgttcctgaacggcgaaaccttc
ggccagggccgcatgagcatcgaggaaatcgtcgccaagctcgattccggcgcggcgcag
cgcgaagccgacaagctcgcgcaaaaggacgtgttcgacatgctggtcgtcggcggcggc
ccggcaggagcggcggcggcgatttattccgcccgcaagggcatccgcaccggcgtggtg
gccgagcgcttcggcggccaggtattggacaccatgggcatcgagaacttcatttcggtg
aaggaaaccgaagggccgaagctggccgccgccctggaacagcacgtcaagagctacgac
gtcgacgtgatgaacatgcagcgtgcagccgccctggtgccgggcgacctcatcgaggtc
aagctcgccggcggcgcttccctgaaggcgaaaaccgtggtgctggccaccggcgcgcgc
tggcgcgagctgaacgtgccgggcgagcagcagtaccgcaaccgcggcgtggcctactgc
ccgcactgcgacggcccgttatttaaaggcaagcgtgtcgcggtggtcggtggcggcaat
tccggcgtggaagcggcgatcgacctggccggcatcgtggcgcacgtcacgctgctggaa
tacgacagccagctgcgcgccgacgccgtgttgcagcgcaaactgcacagcctgccgaat
gtcacggtcatcaccagcgcccagaccaccgaagtcaccggcgacggcagcaaggtcaac
ggcatgcgctacaccgaccgcaacagcggcgagtcgaagcatgtcgagctggaaggcatc
ttcgtgcagatcggcctgctgcccaacaccgactggctcaagggcaccgtcgccttgagc
aatcgcggtgaaatcgaagtcgacgcgcatggccgcacatcggtgccgggcgtgttcgcc
gcgggcgacgcgaccaccgtgccgtacaagcagatcgtcatcgcgatgggagaaggctcc
aaggcggcgctttcggccttcgaccacctgatccgcacctccgcgccggccgaggagaaa
gcagcgatcgcagcataa

DBGET integrated database retrieval system