KEGG   Nonlabens sp. MIC269: AAT17_09260Help
Entry
AAT17_09260       CDS       T04144                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nom  Nonlabens sp. MIC269
Pathway
nom00010  Glycolysis / Gluconeogenesis
nom00020  Citrate cycle (TCA cycle)
nom00620  Pyruvate metabolism
nom01100  Metabolic pathways
nom01110  Biosynthesis of secondary metabolites
nom01120  Microbial metabolism in diverse environments
nom01130  Biosynthesis of antibiotics
nom01200  Carbon metabolism
Module
nom_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAT17_09260
   00020 Citrate cycle (TCA cycle)
    AAT17_09260
   00620 Pyruvate metabolism
    AAT17_09260
Enzymes [BR:nom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AAT17_09260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 RnfC_N HlyD_3 QRPTase_N PYNP_C ATP-gua_Ptrans CPSF100_C
Motif
Other DBs
NCBI-ProteinID: ALM21404
LinkDB All DBs
Position
2005920..2007572
Genome map
AA seq 550 aa AA seqDB search
MAEIVNMPRLSDTMEEGVVAAWLKQVGDQVEEGDILAEIETDKATMEFESFQSGTLLHIG
VQEGETAPVDSLLCIIGEEGEDIQALLDGAGDSSNTENEDSSKTQDSNEDKNDEASSSTD
DSNDLPDGVEIITMPRLSDTMEEGTVASWLKKEGDQVEEGDILAEIETDKATMEFESFHS
GTLLKIGIQEGETAAVDALLAIIGPEGTDVSNVSLDGASNSSKKKEEKKEAPAKEEPKSQ
PKKQEPKKEETKTVSNSSNSTSSSNTGRVFASPLAKKMAQDKGIDLSQVQGSGENGRIIK
KDIESFTPGTSTGVSQPAFEAVGEETFVEMANSQMRKTIAKRLSQSKFTAPHYYLGIELD
MDNAIASRKAINELPDTKVSFNDMVIKAAAMALRKHPQVNTQWTDKNTIQAKHIHVGVAV
AVDDGLLVPVLPFADQMSMQQIGAKVKELAVKARNKKLQPKEMEGSTFTISNLGMFGITE
FTSIINQPNSAIMSVGTIVQKPVVKNGQIVVGNTMKITLACDHRTVDGATGAAFLQTFKQ
YMENPIVMYV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattgtaaacatgcctagattaagcgacaccatggaagaaggtgttgtggca
gcgtggcttaagcaagtaggtgatcaagttgaagaaggtgatattcttgcagaaattgaa
acagacaaggctaccatggaatttgaatcatttcaaagtggtacactattacacataggt
gttcaagaaggtgaaaccgcaccagttgattctctgttatgtataatcggtgaagaaggt
gaggatattcaagctttactagatggcgctggcgattcatccaatacagaaaacgaagat
tcttctaaaactcaagattcaaatgaagataagaacgatgaagcttcatcttcaactgat
gattctaatgatttacctgatggagtggaaatcattactatgccgcgattaagtgatacc
atggaagaaggtacagttgcaagctggttgaaaaaagaaggtgatcaagttgaagaaggt
gatatccttgcagaaattgaaacagataaggctaccatggagtttgagtcatttcatagt
ggaactcttcttaaaattggtatacaagaaggagaaactgctgctgtagacgctttgtta
gctatcattggtcctgaagggacagatgtttccaatgtatccttagatggggcttctaac
tcatcaaaaaagaaggaagagaaaaaagaagcaccggccaaagaagaaccaaaatctcaa
ccaaaaaagcaagagcctaagaaggaagaaacaaagactgtttctaattcaagtaactca
acttctagtagtaatacaggccgtgtttttgcatcaccactagcaaagaagatggctcag
gataaaggaatcgacttgtcgcaggttcaaggttctggagaaaatggtcgtatcattaaa
aaggatatagaaagttttactcctggaacttctacaggtgtctctcaacctgcttttgaa
gctgttggagaagagacatttgttgaaatggcaaattctcaaatgcgcaagaccattgca
aaacgtttgagccaatccaaatttacagcaccacattattatctaggaattgaactagat
atggataatgctattgcaagtagaaaggcaatcaatgagttgccagatactaaggtgagt
tttaatgatatggtcattaaagcagctgcaatggcgttgagaaaacatccacaggtgaat
actcaatggacagataaaaacaccattcaggcgaagcatattcacgtaggagtggctgtt
gccgttgatgatggtttactggttccagtgttaccgtttgcagatcaaatgagtatgcaa
caaataggtgcaaaagtaaaagagctagcagttaaagcccgtaataaaaagttacaacct
aaggaaatggaaggtagtacttttactatttcaaatcttggaatgtttggtattacagaa
tttacttctataatcaatcagcctaacagtgctatcatgtcagtaggtactattgttcaa
aaaccagtggtcaaaaacggtcagattgttgttggcaatactatgaaaatcacattagct
tgtgatcaccgtacagttgatggtgcaacgggagctgcattcttacaaacatttaaacaa
tacatggaaaaccctatcgttatgtacgtatag

DBGET integrated database retrieval system