KEGG   Nostoc sp. NIES-3756: NOS3756_01140Help
Entry
NOS3756_01140     CDS       T04170                                 

Definition
(GenBank) Glutathione S-transferase-like protein
Organism
non  Nostoc sp. NIES-3756
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 Glutaredoxin GST_C GST_C_3 GST_C_5 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: BAT51192
UniProt: A0A0S3P5W9
LinkDB All DBs
Position
141339..142004
Genome map
AA seq 221 aa AA seqDB search
MAEIKIYSAVTCPYAHRTRLVLQEKGIDFELNEIDLQNKPANFTDISPYGKVPALVHGDK
RVWESAIINEYLDEVFPNPPLLPKNPIDRAQARIWIDFANTRLVPAFSNLLRNPDIQKQE
EAKKELYKHLEFIENEAFGKLSLNGPYWFGESVSLVDFTFYPWFERWPALKQYRGFGIPT
EFTRIRQWKHALKELDSVKAIANPKEFYIEKYARFATPVAV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatcaaaatttacagtgcagttacttgtccttatgctcatcggacaagactt
gttctgcaagagaagggtatcgactttgaactgaatgaaattgatttacagaataaacct
gccaactttactgatatttctccttatggaaaagtacctgcacttgtacatggggataaa
agagtatgggagtcagcaattattaatgagtatctagatgaggtattccccaatcctcca
ttgttaccaaaaaatcctattgatagagcgcaggctcggatttggattgattttgcaaac
actagattagttccagctttttctaatttgttgcgaaatcccgatatccaaaaacaagag
gaagccaaaaaggaactatacaaacatctggaatttatcgaaaatgaagctttcggtaaa
ttgtctttgaatggcccctattggtttggtgaatctgttagtttagttgatttcactttc
tatccttggtttgagcgctggcctgctttgaaacagtatcgtggttttggtatccctacc
gaatttacccgcatacgccaatggaagcacgcactcaaagaactggattcagtcaaggcg
atcgccaatcccaaagagttctatattgagaaatatgctagatttgctacccctgtcgct
gtctag

DBGET integrated database retrieval system