KEGG   Nostoc sp. NIES-3756: NOS3756_03060
Entry
NOS3756_03060     CDS       T04170                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00010  Glycolysis / Gluconeogenesis
non00020  Citrate cycle (TCA cycle)
non00620  Pyruvate metabolism
non01100  Metabolic pathways
non01110  Biosynthesis of secondary metabolites
non01120  Microbial metabolism in diverse environments
non01200  Carbon metabolism
Module
non_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOS3756_03060
   00020 Citrate cycle (TCA cycle)
    NOS3756_03060
   00620 Pyruvate metabolism
    NOS3756_03060
Enzymes [BR:non01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NOS3756_03060
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Other DBs
NCBI-ProteinID: BAT51383
LinkDB
Position
complement(380272..381570)
AA seq 432 aa
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVQAGDSAPVGAAIAYVAETEAEIEAAKSLGSSGGAAATTTTAPEPVAATATVGAPATAS
QNGSNHREGRLVASPRARKLAKELKVDLTSLKGSGPYGRIVADDIEAAVGKVKQPAVSPA
APTPAVTPVAPPPAPRTPAPAPAPVAAAPGQVVPFNTLQNAVIRNMVASLDVPVFRVGYT
ITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNARYSDQGLVYHPDINIAVAVA
MDDGGLITPVLKNADKVDIYSLSRTWKSLVDRARSKQLQPDEYTGGNFTLSNLGMFGVDT
FDAILPPGQGSILAIGASRPQLVATADGSFGIKQQMQVNITSDHRIIYGADAAAFLQDLA
KLIETDAHSLTL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcattcacgaaatcttcatgccggcgctgagttccaccatgaccgaaggcaaaatc
gtctcctgggtgaaatcgccaggtgataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagacaaggcagatatggatgtagaaaccttttatgaaggatatcttgcccacatc
attgtacaagctggtgatagcgcccctgtaggagctgcgatcgcctacgtcgccgaaaca
gaagccgaaatcgaagccgccaaatctttaggtagttctggtggcgctgcggctaccacc
accaccgcccctgaaccagttgccgctaccgccaccgtaggcgcaccagccaccgcttca
caaaatggttctaaccaccgtgagggaaggcttgtagcttcaccccgcgcccgtaagttg
gcgaaagaattgaaagtcgatttgacaagtcttaaaggtagcggcccctacggtcgcatt
gttgctgatgatattgaagcggctgtaggcaaagttaagcaaccagcagtatcacctgct
gcacctacaccagccgttaccccagtcgcacctccaccagcacctcggactcctgcaccc
gcgccagcaccagtagcagctgcgcctgggcaagttgtaccattcaacaccctgcaaaac
gccgtcatccgtaacatggtggccagcctggatgtacctgtattccgtgtaggttacaca
atcaccaccgatggtttagacaaactttacaaacaaattaaatccaaaggtgtaaccatg
acagcgctactagcgaaagctgtagcggtgacattacaaaaacacccattattaaacgcc
cgttattcagaccaaggactcgtttaccatcccgatatcaacattgccgtagctgtggca
atggatgatggtggtttaattacaccagtgttaaaaaatgccgacaaggtagatatttac
tcactatcacgcacttggaaatctcttgtagatagagcgagaagcaaacaactccaacca
gatgaatacactggcggtaacttcaccctgtccaacttgggaatgtttggtgtagataca
tttgatgccattttacccccaggacaaggttcaattttagcgatcggtgcatctcgtccg
caattggtagccactgccgatggctcgtttggtattaagcagcaaatgcaggtcaatatt
acatccgatcaccggattatttatggtgctgacgcggcagcgtttttacaagacctagct
aagttgattgagactgacgctcattctttgacgctttaa

DBGET integrated database retrieval system