KEGG   Nostoc sp. NIES-3756: NOS3756_03060Help
Entry
NOS3756_03060     CDS       T04170                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00010  Glycolysis / Gluconeogenesis
non00020  Citrate cycle (TCA cycle)
non00620  Pyruvate metabolism
non01100  Metabolic pathways
non01110  Biosynthesis of secondary metabolites
non01120  Microbial metabolism in diverse environments
non01130  Biosynthesis of antibiotics
non01200  Carbon metabolism
Module
non_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOS3756_03060
   00020 Citrate cycle (TCA cycle)
    NOS3756_03060
   00620 Pyruvate metabolism
    NOS3756_03060
Enzymes [BR:non01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NOS3756_03060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: BAT51383
UniProt: A0A0S3P7F1
LinkDB All DBs
Position
complement(380272..381570)
Genome map
AA seq 432 aa AA seqDB search
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVQAGDSAPVGAAIAYVAETEAEIEAAKSLGSSGGAAATTTTAPEPVAATATVGAPATAS
QNGSNHREGRLVASPRARKLAKELKVDLTSLKGSGPYGRIVADDIEAAVGKVKQPAVSPA
APTPAVTPVAPPPAPRTPAPAPAPVAAAPGQVVPFNTLQNAVIRNMVASLDVPVFRVGYT
ITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNARYSDQGLVYHPDINIAVAVA
MDDGGLITPVLKNADKVDIYSLSRTWKSLVDRARSKQLQPDEYTGGNFTLSNLGMFGVDT
FDAILPPGQGSILAIGASRPQLVATADGSFGIKQQMQVNITSDHRIIYGADAAAFLQDLA
KLIETDAHSLTL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcacgaaatcttcatgccggcgctgagttccaccatgaccgaaggcaaaatc
gtctcctgggtgaaatcgccaggtgataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagacaaggcagatatggatgtagaaaccttttatgaaggatatcttgcccacatc
attgtacaagctggtgatagcgcccctgtaggagctgcgatcgcctacgtcgccgaaaca
gaagccgaaatcgaagccgccaaatctttaggtagttctggtggcgctgcggctaccacc
accaccgcccctgaaccagttgccgctaccgccaccgtaggcgcaccagccaccgcttca
caaaatggttctaaccaccgtgagggaaggcttgtagcttcaccccgcgcccgtaagttg
gcgaaagaattgaaagtcgatttgacaagtcttaaaggtagcggcccctacggtcgcatt
gttgctgatgatattgaagcggctgtaggcaaagttaagcaaccagcagtatcacctgct
gcacctacaccagccgttaccccagtcgcacctccaccagcacctcggactcctgcaccc
gcgccagcaccagtagcagctgcgcctgggcaagttgtaccattcaacaccctgcaaaac
gccgtcatccgtaacatggtggccagcctggatgtacctgtattccgtgtaggttacaca
atcaccaccgatggtttagacaaactttacaaacaaattaaatccaaaggtgtaaccatg
acagcgctactagcgaaagctgtagcggtgacattacaaaaacacccattattaaacgcc
cgttattcagaccaaggactcgtttaccatcccgatatcaacattgccgtagctgtggca
atggatgatggtggtttaattacaccagtgttaaaaaatgccgacaaggtagatatttac
tcactatcacgcacttggaaatctcttgtagatagagcgagaagcaaacaactccaacca
gatgaatacactggcggtaacttcaccctgtccaacttgggaatgtttggtgtagataca
tttgatgccattttacccccaggacaaggttcaattttagcgatcggtgcatctcgtccg
caattggtagccactgccgatggctcgtttggtattaagcagcaaatgcaggtcaatatt
acatccgatcaccggattatttatggtgctgacgcggcagcgtttttacaagacctagct
aagttgattgagactgacgctcattctttgacgctttaa

DBGET integrated database retrieval system