KEGG   Nostoc sp. NIES-3756: NOS3756_03420Help
Entry
NOS3756_03420     CDS       T04170                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00061  Fatty acid biosynthesis
non00780  Biotin metabolism
non01100  Metabolic pathways
non01130  Biosynthesis of antibiotics
non01212  Fatty acid metabolism
Module
non_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NOS3756_03420
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NOS3756_03420
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NOS3756_03420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:non01004]
    NOS3756_03420
Enzymes [BR:non01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NOS3756_03420
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NOS3756_03420
Lipid biosynthesis proteins [BR:non01004]
 Fatty acid synthase
  Component type
   NOS3756_03420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: BAT51419
LinkDB All DBs
Position
419408..420184
Genome map
AA seq 258 aa AA seqDB search
MLNLTGKNALVTGIANNRSIAWGIAQQLHAAGANLGITYLPDERGKLEKKVAELVEPLNP
SLFVPCNVQNDEQIQATFDTIRDKWGKLDILIHCLAFANRDDLTGNFSQTSRAGFATALD
ISTYSLVQLSGAAKPLMTEGGSIITLTYLGGVRAVPNYNVMGVAKAGLEASVRYLASELG
PQNIRVNAISAGPIRTLASSAVGGILDMIHHVEEVAPLRRTVTQTEVGNTAAFLASDLAS
GITGQVLYVDAGYEIMGM
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatctgaccggaaaaaatgccttggttacaggtattgccaataatcgctccatt
gcctggggaattgcccaacaactgcacgccgccggagcaaaccttggtattacttaccta
ccagatgaacgcggcaaattggaaaaaaaagttgcggaactagtagaaccgctcaacccc
agcttattcgttccttgtaatgttcaaaatgatgaacaaattcaggctacctttgatact
atccgcgataaatggggcaagttagatattctgattcattgtttggcttttgctaacaga
gatgatttaacaggaaattttagccaaacttctcgtgctggctttgccacagctttggat
atcagcacttattcattagtacaattaagcggtgcagctaaacctctaatgacagaaggc
ggtagtattatcaccttgacatatttaggcggtgtcagggcagttcctaactacaacgtt
atgggagttgccaaagcaggtttagaagcaagtgtccgttatttagcatctgaactcggc
ccccaaaatattcgtgttaatgccatctctgctggccctatccgcaccttggcatctagt
gccgtcggcggcattttagatatgattcaccatgtagaagaagtagctcccttacgtcgt
actgtcacccaaacagaagtaggcaataccgccgctttcctagcaagtgatttagccagt
ggtatcaccggacaagtcctgtatgtggatgcaggatatgaaattatgggaatgtaa

DBGET integrated database retrieval system