KEGG   Nostoc sp. NIES-3756: NOS3756_26290Help
Entry
NOS3756_26290     CDS       T04170                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00040  Pentose and glucuronate interconversions
non00051  Fructose and mannose metabolism
non01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NOS3756_26290
   00051 Fructose and mannose metabolism
    NOS3756_26290
Enzymes [BR:non01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     NOS3756_26290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C ADH_zinc_N_2 Cas_csx3
Motif
Other DBs
NCBI-ProteinID: BAT53668
LinkDB All DBs
Position
3047442..3048488
Genome map
AA seq 348 aa AA seqDB search
MKAQVFRGVNQLSYEDIPVPTLEPDEVLVQVQVVGLCQSDIKKIRYPLYEPPRIFGHETA
GTIAAVGSQVQGWQVGQRVAVMHHIPCMRCAYCLNDNFSMCNVYKNISTTAGFNPSGGGF
AEYVKVPGHIVQNGGLIPIPDNISFEEASFVEPTNCCLKAVKKAQIEPGQTVLVTGAGPI
GLMFIMLVKYFGAKAIATDLLPSRIDKALNVGAEAAFDARDPDLSAKIHALTDGFGVDVT
LLAVPSEKAFFQALDFTRKGGKILFFAEFPDELEIPLNPNILYRREIDLMGSYSSSYRLQ
NLSADIVFNRRIDVQALISDRYPLKDLSAAVDQAIAPTPETYKILIYP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacaggtatttagaggtgtaaatcagctatcttacgaagacatccccgtaccg
actctggaaccggatgaagtgctggtacaggtgcaagtagtcggtttgtgtcagtcagat
attaaaaaaattcgctatcctctgtatgaaccaccgcgtattttcggacatgaaacagcc
gggactattgccgcagtcggttctcaagtacaagggtggcaggtaggacaacgggtagca
gttatgcaccacattccttgtatgcgttgtgcctactgcttgaatgataatttttctatg
tgcaatgtttacaaaaacatttccaccacagctggatttaaccctagtggtggcggtttt
gctgaatatgtcaaagttcctggtcatattgtccagaatggtggtttgatacccatcccc
gacaatattagttttgaagaagcaagttttgtcgaaccaactaactgctgcttaaaagca
gtgaaaaaagcccaaattgagccaggacaaaccgttctggtaactggtgcggggccgatt
gggttaatgtttatcatgttggttaaatattttggggcaaaagcgatcgccaccgatttg
ttaccctcaagaatagacaaagccctcaacgtcggtgcagaagcagcatttgatgcccgt
gatcccgatttaagcgcaaaaatccacgccctcaccgatggctttggtgttgatgtgaca
ctcttagctgttcccagtgaaaaagccttctttcaagccctcgactttactaggaagggc
ggaaaaatcctattttttgccgaatttcccgacgaattagaaatccccctaaaccccaac
attctctaccgccgtgaaatcgacttgatgggcagttacagttcatcctatcgcttacaa
aatctctcggcggatatcgtattcaatcgtcgtattgatgtgcaagcattaattagcgat
cgctatcctctaaaagatttatcagcagccgtagaccaagcgatcgcacccacaccagaa
acttataaaatcctgatttatccgtaa

DBGET integrated database retrieval system