KEGG   Nostoc sp. NIES-3756: NOS3756_31890Help
Entry
NOS3756_31890     CDS       T04170                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00010  Glycolysis / Gluconeogenesis
non00053  Ascorbate and aldarate metabolism
non00071  Fatty acid degradation
non00280  Valine, leucine and isoleucine degradation
non00310  Lysine degradation
non00330  Arginine and proline metabolism
non00340  Histidine metabolism
non00380  Tryptophan metabolism
non00410  beta-Alanine metabolism
non00561  Glycerolipid metabolism
non00620  Pyruvate metabolism
non00625  Chloroalkane and chloroalkene degradation
non01100  Metabolic pathways
non01110  Biosynthesis of secondary metabolites
non01120  Microbial metabolism in diverse environments
non01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOS3756_31890
   00053 Ascorbate and aldarate metabolism
    NOS3756_31890
   00620 Pyruvate metabolism
    NOS3756_31890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NOS3756_31890
   00561 Glycerolipid metabolism
    NOS3756_31890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOS3756_31890
   00310 Lysine degradation
    NOS3756_31890
   00330 Arginine and proline metabolism
    NOS3756_31890
   00340 Histidine metabolism
    NOS3756_31890
   00380 Tryptophan metabolism
    NOS3756_31890
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NOS3756_31890
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NOS3756_31890
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NOS3756_31890
Enzymes [BR:non01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     NOS3756_31890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: BAT54223
UniProt: A0A0S3PER2
LinkDB All DBs
Position
complement(3696323..3697789)
Genome map
AA seq 488 aa AA seqDB search
MVTAKEPKQLVKIGPTRLLINNEWVESVSGQRFETINPATGEVICDVAQADAADVDKAVK
AARAAFNGEWSKISATRRGDLLYKLADLIEQNIDELARLETLDNGKPLQDSLGDLSLVIA
CYRYYAGWADKVQGKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAWKLAPALATGN
VVVMKTAEQTPLSALRVGELIVEAGFPPGVVNILSGYGPTAGAAISHHMDVDKVAFTGST
EVGHLIMEAAAKTNLKRVTLELGGKSPNIVFADADFDEAIAGAHDAIFFNQGQCCCAGSR
LFVEEKCYDEFVARTVEQARRRVVGDPFDANTQQGPQVDKEQFDKVMGYIESGMRDGAQM
LCGGNRVGEQGFFIAPTVFADVRDDMKIAQEEIFGPVMSIIKFKDIDEVIQRANTTMYGL
AAAVWTKDITKAHAIANNVRAGTVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLQQYTE
VKTVTIKL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggttacggcgaaggaaccaaagcaactggtgaaaatcggcccaaccaggctgctaata
aacaatgaatgggtggaaagtgttagcggtcagagatttgagacaattaatccagccacg
ggcgaggtcatctgcgatgtagcccaagcagatgcggcagatgtggataaggctgtaaaa
gcagcccgtgccgctttcaatggagaatggtcaaagatatctgctactagaaggggcgat
ttgctttataagttagcagatttaattgagcagaatattgatgagttggcgcggttagaa
actctagataacggtaaacctttacaagattctttgggtgatttgtctttagtcattgcc
tgctatcgttactacgcaggttgggcggataaggtacaaggaaaaaccatcccaattaat
ggaccgtatttctgttacactcgccatgaaccggtgggtgtggttgggcaaattatccct
tggaattttcccttgttaatgcaggcgtggaagttagcaccagctttagcaacgggtaat
gttgtggtgatgaaaacagccgaacaaactccactatcagcgctacgggtgggagagttg
attgtggaagctgggtttcctcctggggtggtgaatattttatcaggatacgggccaacg
gctggggcggccatatctcatcatatggatgtagataaggtggcattcactggttcgacg
gaagtgggacatctaattatggaagcggccgctaaaactaacttgaagcgggtaactttg
gaattaggtggtaagagtcccaatattgtgtttgctgacgctgactttgatgaagcgatc
gccggcgctcacgatgcgatattctttaaccaaggtcagtgttgttgcgctggttcgcgg
ctatttgtggaagagaaatgttatgacgagtttgtcgccagaactgtagaacaagctaga
aggcgtgtagttggtgatcccttcgatgccaatacccaacaagggccgcaggtagataaa
gaacaattcgacaaagtaatgggttacatcgagtcggggatgcgtgatggcgcacagatg
ttgtgtggtggaaatcgcgttggggaacagggcttttttatcgcccccaccgtctttgcg
gatgtgcgcgacgatatgaagattgcccaagaggaaatttttggcccagtgatgagtatc
atcaagttcaaagacattgatgaggtgatacaacgggcaaacactaccatgtatggactc
gccgccgccgtttggacaaaggatatcactaaagctcatgcgatcgctaacaatgtgcgt
gcgggtacagtatgggtaaactgttacgacgtattcgatgcggctgcaccttttggtggg
tttaagcagtctggtattggtcgagaactaggtgaatatgggttgcaacagtacacggaa
gtgaagactgtgactatcaagttgtaa

DBGET integrated database retrieval system