KEGG   Nostoc sp. NIES-3756: NOS3756_48210Help
Entry
NOS3756_48210     CDS       T04170                                 

Definition
(GenBank) Glutathione S-transferase-like protein
Organism
non  Nostoc sp. NIES-3756
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: BAT55828
UniProt: A0A0S3PJA4
LinkDB All DBs
Position
5639455..5640126
Genome map
AA seq 223 aa AA seqDB search
MSNLQLYFAKASTFSQRTRVVLLEKGIDFTPVEIDLQNKPEGYTQISRYGKVPAIKHGDV
VIYESAIVNEYLDEVFPEPALLPRDPAKKAIARIWIDYANTRFVPAFNKFLRGKDSQEQE
QGRKEFTEALLYIEQEAFGEGEYFLGDQFSLVDISFYPWFERLPLLEHFRKFTLPAETPH
LQTWWNLVRDRTSVQAVANPVDFYLERFAKILGEPVPVGAAQK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacttacaactttacttcgctaaagcatctaccttctcgcaacgtacccgtgta
gttttactagagaaaggtatcgattttactccagtagaaattgatttacaaaacaagcca
gaaggctatacgcaaatttcccgctatggtaaagttccagctattaagcatggcgatgtt
gtaatttacgaatctgctattgtcaatgagtatctagatgaagttttcccagaaccagcg
ttattacctcgtgatcctgccaaaaaagcgatcgctcgtatctggatagactacgctaat
actcgttttgtccctgcatttaacaaattcctacgcggtaaagatagccaagaacaggaa
caaggacgaaaagagtttacagaagcacttttatatatagaacaggaagcctttggtgaa
ggtgaatatttcttaggtgatcagtttagtttggttgatatcagtttctatccttggttt
gaacgcctaccactattagaacacttccgtaaatttacactcccagcagaaacacctcat
ttgcagacatggtggaatttagtacgcgatcgcacttcagttcaagcagtagccaatcct
gtagacttctatctagaaagatttgccaaaattcttggtgaacctgttcctgttggtgca
gcacaaaaataa

DBGET integrated database retrieval system