KEGG   Nostoc sp. NIES-3756: NOS3756_52350Help
Entry
NOS3756_52350     CDS       T04170                                 

Definition
(GenBank) Alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00500  Starch and sucrose metabolism
non01100  Metabolic pathways
non01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NOS3756_52350
Enzymes [BR:non01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     NOS3756_52350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: BAT56232
LinkDB All DBs
Position
complement(6101500..6104064)
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPTRLEPLRRLAYNLHWDWNVETKDLFRRLDPDLWESSHHNPVLMLGT
ISQGRLLEVVEDEGFLAQMDRADRQLEEYLQERSWYKKQRHQKPKECFAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYPINDFYNM
PLHLERNADGSELRVAVDYPGRKIYARVWRVQVGTVPLYMLDTNIEPNNPYDQDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYKVTAYHMNEGHAAFSALERIRLLIQQEGLSYAE
AKQVVSSSNIFTTHTPVPAGIDLFPPDKILYYLGYYADIFGLPKEQFLGLGRENTGDLSG
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWKKVPVEEVPITAITNGVHARSCVAKS
TQELYDRYLGPNWSSVPPDNQLWERMDAIPDEELWRNHERCRLDMILYVRDHLVKHLRDR
GASPSDIVQAQEVLDPNALTIGFARRFATYKRATLWMRDIERIRRILLADKDRKVQFVIA
GKAHPKDIPGKELIREINHFIREQHLEKQVVFVPNYDIYISRLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGENYEDPNYQDEVEANALYDLL
EKEVVPLFYDHRDIDGLPRPWVAKMKDAIRLNCPFFNTARMVREYALRAYFPASDRYYTL
TSDNYAPAKELATWKAALSDHWFNIKIKDIDVSAGADIEVNQTVAVKAKVDLATLTNDDV
QVELYQGAIDASGDIVNAIPVVMDYQGQDSGGLSVYTANILYTTSGLQGLSLRVLPKHPY
LSNPYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgtacattcaatgtctctccttctttgccgacgcggctagaaccgttg
cggcgactggcttataatttacattgggattggaacgtcgagactaaagatttatttcgt
cgcttagacccagatttatgggagtctagccatcataaccccgtattaatgttgggtaca
atcagtcaggggcggcttttggaagtcgtggaagatgaaggttttctggcacagatggat
cgtgccgatcgccaactagaggaatatttacaagaacgcagttggtataaaaagcagcgt
catcagaaacctaaagaatgtttcgcctatttttcggcggagtttgggttggtagattgt
ctgcccgtttattctggtggtttgggcgttttggcgggagatcacttgaaatcagccagt
gatttagggctacccttagttggtgtgggtttattgtaccagcaaggctactttgctcag
tatctcaatgccgacggctggcagcaagaacgttacccgattaacgatttctataatatg
cccttgcacctagaacgcaatgccgacggctcagaactgcgagttgcggtagattatcca
ggacgcaagatttacgccagagtttggcgtgtacaggtagggacagtacccctgtatatg
ctagataccaacatcgaaccgaataacccttacgaccaagacattaccgaccaactctat
ggcggtgatatcgatatgcgtatccaccaagaaattatgttggggattggtggtgtacaa
atgttgaaagccttgggttataaggtgactgcttaccacatgaatgaaggtcacgccgct
ttctcagccctagaacgcatccgcttgttgattcagcaagagggtttgagttatgcagaa
gctaaacaggtggtgagttctagtaatatctttaccactcatactccagtaccagccgga
attgacctattcccacccgacaaaattctgtattaccttggttattatgcagatatcttt
ggtttacctaaagagcaatttttaggactgggacgggaaaatacaggtgatttatctggc
ccctttagtatggcggtgttggcgttgaagatggcaacattttctaacggtgtcgcccag
ttacacggtgtggtttcccggcaaatgttccaaggtttgtggaagaaagttccggtggaa
gaagtacccatcacagccattactaacggtgttcatgcccgtagttgcgttgctaagtca
acccaggaattatacgatcgctatttagggccaaattggtcatcagtaccaccagataac
caattgtgggaacggatggatgcaattcccgatgaggagttgtggcgtaatcatgaacgt
tgccgtttggacatgatactgtatgtgcgtgaccatttagtaaaacatttgcgcgatcgc
ggtgcttccccttccgatattgtccaagcccaggaagtcctcgaccccaatgcgttaact
attggctttgcccgtcgctttgccacctacaaacgtgctactctgtggatgcgcgacatt
gaacggattaggcgcatcttactagccgacaaagaccgtaaggtgcaatttgtcatcgct
ggtaaagcccaccccaaagatatccccggaaaagaactgatccgcgaaattaatcacttt
atccgcgaacagcatttagaaaaacaagtcgtgtttgttcccaactacgatatttatatt
tctcggttgatggtggctggctgtgacatttggttaaacacaccccgccgtcccagagaa
gcatcgggtacaagcgggatgaaagccgcaatgaatggcttacctaacctgagtgtgtta
gatggttggtgggatgaagccgattatgtccgcactggctgggctattggacatggggag
aattatgaagaccccaactaccaagatgaagtagaagccaatgctctctacgatttacta
gagaaagaagtcgtacccctattttacgaccaccgcgatatcgatggtttacccagacct
tgggttgctaaaatgaaggatgctattcggttaaattgcccattctttaatacagcgcgg
atggtgcgagaatatgcactacgggcttatttccccgcaagcgatcgctactatacctta
acatctgataattacgcaccagctaaagaattagcaacttggaaagcagcacttagtgac
cactggtttaatatcaaaatcaaagatatcgatgtatccgcaggtgcagatatcgaagtt
aatcaaaccgtcgctgtcaaagctaaggtagacttggcaactttaaccaatgatgatgta
caagtcgaactatatcaaggtgcgattgatgccagtggggatattgtcaacgctatacct
gtagtcatggattatcaaggacaggatagcggagggttaagtgtttatacagctaatatc
ctttacaccacttccggtttacaaggcttgtccttgcgcgtattacccaaacacccgtat
ctgtctaacccttatgagcctagattgattgcttgggcggagtaa

DBGET integrated database retrieval system