KEGG   Nostoc sp. NIES-3756: NOS3756_54110Help
Entry
NOS3756_54110     CDS       T04170                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00260  Glycine, serine and threonine metabolism
non00270  Cysteine and methionine metabolism
non00680  Methane metabolism
non01100  Metabolic pathways
non01120  Microbial metabolism in diverse environments
non01130  Biosynthesis of antibiotics
non01200  Carbon metabolism
non01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    NOS3756_54110
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NOS3756_54110
   00270 Cysteine and methionine metabolism
    NOS3756_54110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:non04147]
    NOS3756_54110
Enzymes [BR:non01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     NOS3756_54110
    1.1.1.399  2-oxoglutarate reductase
     NOS3756_54110
Exosome [BR:non04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NOS3756_54110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BAT56406
LinkDB All DBs
Position
6287073..6288653
Genome map
AA seq 526 aa AA seqDB search
MSKVLVSDPIDQAGIDILSQVATVDVKTGLKPAELIEIIGEYDALMIRSGTRVTQEIIEA
GTQLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMMLSLSRHIPDANA
SVKRGEWDRKTFVGAEVYKKTLGVVGLGKIGSHVATVAKAMGMKLLAYDPFISTERAEQL
GCQLVDLDLLMQQSDYITLHIPKTPETTHLINANTLAKMKPTARIINCARGGIIDEAALA
AAIKEGKIAGAALDVFESEPLGESELRSVGKDIILTPHLGASTTEAQVNVAIDVAEQIRD
VLLGLPARSAVNIPGLGPDVLEELKPYMELAETLGKLVGQLAGGRVELLTVRLQGELATN
KSQPLVIASLKGLLHQALRERVNYVNANIEAKERGIRVIETRDASARDYAGSLRLEATGT
LGTHSVTGALLGEKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNI
ASMQVGRKIVRGDAVMALSIDDPLPDGILEEITKVPGIRDAYTVTL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaggttctcgtctccgatcctattgaccaggctggcattgacattctctcgcaa
gtcgctaccgttgatgtcaaaacaggtcttaaaccagcagaattaatagaaattattggt
gagtatgatgcgttaatgattcgttctggtacgcgcgttactcaagaaatcattgaagca
ggtacacaactcaaaatcatcggtcgtgccggtgtgggtgtggataatgtggatgttccg
gctgctactcgtcgaggaattgttgtcgtcaattccccagaaggtaacaccatcgccgcc
gccgaacacgccctagcaatgatgctgtcattgtctcgccacatccccgatgctaacgct
tccgtcaagcgcggcgagtgggatcgtaaaactttcgtaggtgcggaagtttacaaaaaa
actttaggggttgtcggcttaggcaaaataggttcccatgtggcgacagtagccaaagca
atggggatgaaattgttagcttacgatcccttcatctctacagaacgggcagaacaacta
ggctgtcagttggtagatttagatttgctaatgcagcaatctgattatattaccctacac
atccccaaaaccccagaaactacccacctgataaacgccaacactctggcgaaaatgaaa
cccaccgcccggattattaactgcgcccgtggtggcatcattgatgaagcagccttagcc
gcagcgattaaagaagggaaaattgcgggtgcggcgttggatgtgttcgagtcagaacct
ttgggcgagtcagaattgcgctcagttggtaaagatattatcctcacaccccacttaggc
gcatccaccacagaagcccaggtaaatgtggcgatagatgtagccgaacaaatccgcgat
gtacttttgggtttacctgcacgttccgccgtcaacatccccggactcggccccgatgtg
ttggaagaactcaagccttatatggaactagctgaaactctgggtaagttggtaggacag
ctagcaggtggacgagtggaactactgactgttcgcttacaaggggaacttgccactaac
aagagtcagcctctagtcattgcttccctcaaaggattactacatcaagccttgcgggaa
cgggtgaattacgtcaacgctaatatagaagccaaagaacggggtattcgcgtcatcgaa
acccgcgacgcttccgcccgtgactatgctggttccttacgtttagaagcgaccggaacc
ttgggaactcattctgttactggtgcattgttaggtgaaaaagaaattcacctcaccgac
gtagacggcttcccaattaacgtcccaccaagtaaatatatgctgtttaccttgcaccgc
gatatgccgggaatcatcggcaaactcggctccttactaggcagctttaatgtcaatatt
gcgagtatgcaggtaggacggaaaatcgtccgtggtgatgctgtaatggctctcagcatc
gatgatcctttacccgatggcattttagaggaaattaccaaagtaccgggaatccgtgac
gcatatacagtaactctataa

DBGET integrated database retrieval system