KEGG   Nostoc sp. PCC 7524: Nos7524_0560Help
Entry
Nos7524_0560      CDS       T02363                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00010  Glycolysis / Gluconeogenesis
nop00020  Citrate cycle (TCA cycle)
nop00620  Pyruvate metabolism
nop01100  Metabolic pathways
nop01110  Biosynthesis of secondary metabolites
nop01120  Microbial metabolism in diverse environments
nop01130  Biosynthesis of antibiotics
nop01200  Carbon metabolism
Module
nop_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7524_0560
   00020 Citrate cycle (TCA cycle)
    Nos7524_0560
   00620 Pyruvate metabolism
    Nos7524_0560
Enzymes [BR:nop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nos7524_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase GCV_H
Motif
Other DBs
NCBI-ProteinID: AFY46471
UniProt: K9QMT6
LinkDB All DBs
Position
645795..647078
Genome map
AA seq 427 aa AA seqDB search
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
VVQAGDSAPVGAAIAYVAETEAEIEAAKSMGNSGGAVATPTSAPEPVAVAASVGTPTLAS
QNGSNHKEGRLVASPRARKLAKDLKVDLTSLKGSGPYGRIVAEDVEAATGKTSTPPAPIT
AVPSITPVKPAAPTPAPAPAATVPGQIAPFNTLQNAVIRNMVASLAVPEFRVSYTITTDG
LDKLYKQIKSKGVTMTALLAKAVAVALQKHPLLNASYSDQGVVYHSDINIAVAVAMDDGG
LITPVLKNADQVDIYSLSRNWKSLVERARAKQLQPDEYNSGTFTLSNLGMFGVDTFDAIL
PPGQGSILAIGAARPQVVASPDGLFGVRQQMQVNITCDHRIIYGAHAAAFLQDLAKLIET
DAQSLTL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcacgaaatattcatgccggcgcttagttccaccatgactgaaggcaaaatt
gtctcctgggtaaaatcgccaggcgacaaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttctatgagggatatctggcacatatc
gtagtacaagccggtgacagtgcgcctgtgggggctgcgatcgcttatgttgcagaaact
gaagccgaaatcgaagccgccaaatctatggggaactccggcggtgcagtagcgactcct
acctctgcacctgaaccagttgcagttgcagcctcagtaggaacacctaccctagcatct
caaaatgggtctaaccacaaagaaggcagactcgtagcttcaccaagggcccgcaaatta
gccaaagacctcaaagttgatttgacctctcttaaaggtagcggcccctacggtcggatt
gtcgctgaggatgtggaagcagctacaggtaaaacttctaccccgcctgctcccattact
gccgtcccaagcattaccccagttaaaccagctgcaccaacacccgcaccagcacccgca
gcaactgtccccggtcaaatcgccccattcaatactctacaaaatgccgtcattcggaat
atggtcgctagcctagcagtaccagaattccgtgttagttacacaatcaccactgatggc
ttagacaaactttacaaacaaattaaatccaagggcgtaacaatgacagccctactggca
aaagccgtagcggtggcattacaaaaacatccacttttaaatgctagctattctgatcaa
ggtgtagtttaccactccgacattaatattgccgtagccgtagctatggatgatggtggt
ttaattacacccgtattaaaaaatgccgaccaagtagacatttactcactctcacgcaat
tggaaatctcttgtagagcgcgctagagctaaacaactgcaacccgacgagtacaacagt
ggtacttttaccctgtctaacttggggatgtttggcgtagatacatttgatgcgattcta
ccaccaggacaaggttcgattttagcgatcggtgcagcccgtccccaagttgtcgccagc
ccagacggtttgtttggtgtgcgtcaacaaatgcaggtaaatatcacctgtgaccaccgg
attatttacggcgcacacgctgcggcgtttttacaagatttggctaagttgattgagact
gatgcccaatctttaacactttaa

DBGET integrated database retrieval system