KEGG   Nostoc sp. PCC 7524: Nos7524_1122Help
Entry
Nos7524_1122      CDS       T02363                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00630  Glyoxylate and dicarboxylate metabolism
nop00710  Carbon fixation in photosynthetic organisms
nop01100  Metabolic pathways
nop01120  Microbial metabolism in diverse environments
nop01200  Carbon metabolism
Module
nop_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nop_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nop_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nos7524_1122
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nos7524_1122
Enzymes [BR:nop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nos7524_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFY47015
UniProt: K9QN18
LinkDB All DBs
Position
1292372..1292701
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLSDAQIAKQVQYILNQGYIPAIEFNETSEPTEFYWTMWKLPL
FGAKSTQEVLGEVQACRSQYGNCYIRVVGFDNIKQCQVLSFIVHKPSRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttaccaaaagagcgtcgttacgaaaccctgtcttacctgcctcccctcagc
gacgcgcaaattgccaagcaagtccaatacattctcaatcaagggtacattcctgcgatc
gaattcaacgaaacctctgaacccaccgaattttattggacaatgtggaagctacctttg
tttggtgctaaatccactcaagaagttttgggtgaagttcaagcttgccgttcccagtac
ggtaactgctacatccgtgttgtaggtttcgacaacatcaaacagtgccaagttctcagc
tttatcgttcacaaacccagcagatactaa

DBGET integrated database retrieval system