KEGG   Nostoc sp. PCC 7524: Nos7524_2203Help
Entry
Nos7524_2203      CDS       T02363                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Nos7524_2203
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nop02000]
    Nos7524_2203
Enzymes [BR:nop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Nos7524_2203
Transporters [BR:nop02000]
 Other Transporters
  Pores ion channels [TC:1]
   Nos7524_2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C GST_N GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AFY48049
UniProt: K9QSI7
LinkDB All DBs
Position
2690040..2690696
Genome map
AA seq 218 aa AA seqDB search
MLKFYYNPISINARRVWVALLEKQIPFEPCLVSLDGDQFQENFTAINPLQRVPVIVDEVL
RVVESLAILDYLEAKYPTPSLMPSEPQAIATIRMVEMITLNELQPATMLLTRQLVELDTD
TQKLEFAQQRIAAAVQFYENLLGEQTYFAGEDFTLAEVVAGTLIPSLPMFGFSFETYPRL
LAWAERLEARESWQNTTPSMEAVMAAIPNIKAIIERRT
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagttttactacaatcccatttctatcaatgcgcgtcgtgtttgggtggcatta
ctggaaaaacaaattccctttgagccatgtctagtaagtctagatggggatcagtttcaa
gaaaacttcacggccattaatcccctccagcgtgtccctgtgatagtggatgaggtattg
cgcgtggtggaatctctggcgattttagattatttagaagcgaagtatcccacgccatcc
ttgatgcctagtgagccgcaagcgatcgctacaattcgtatggtagaaatgattacactc
aatgagttgcaacctgctactatgctattaactcggcaattagtcgagttggacaccgat
actcaaaagttagagtttgcccaacagcgcatagcggcagctgtacagttttacgaaaat
cttttaggagaacaaacttactttgctggcgaagatttcaccctagcagaagtggttgct
gggacattaattccttctttgcccatgtttggcttctcctttgagacgtacccccgttta
ttagcatgggcagaacgactagaagcacgggaaagttggcaaaacactactcccagcatg
gaagctgtgatggctgctatccccaacatcaaggcaattatcgaacgccggacttga

DBGET integrated database retrieval system