KEGG   Nostoc sp. PCC 7524: Nos7524_2633Help
Entry
Nos7524_2633      CDS       T02363                                 

Definition
(GenBank) putative transmembrane sensor domain protein
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00230  Purine metabolism
nop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nop00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Nos7524_2633
Enzymes [BR:nop01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Nos7524_2633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHASE2 Guanylate_cyc
Motif
Other DBs
NCBI-ProteinID: AFY48467
UniProt: K9QUK7
LinkDB All DBs
Position
3204301..3206508
Genome map
AA seq 735 aa AA seqDB search
MLGKKLKPVIWQWRGVIFAVPKITVLVIILRLTGLLQLLELAALDQFFLLRPPEPPDRRI
VIVEINEADIQNLGKWPMSDEVLASVLATIKQQQPRAIGLDIYRDLPVDPGHETLVKLFA
NTPNLVGVQKISNSFDSAAVNPPPALKERQQVGSNDLPLDGDGKIRRGLLYVNFNEEDVL
ESFALKLALLYLEAEGITAKPSANNPDYLQLNRGIFPIFTANDGGYIRADDGSYQILLNY
RGRMQQQFSSISLSQLQNNQIPPDFMRGKVVLIGATAESLKDLFYTPYSSKVFAAPERMA
GVTIHANLISQILSAALDNRPLIKNLPEPIELLLILFCSIIGAALCWQQRHYINQKTFLA
VNVIFAGGVLIGSSFVAFLVGWWLPVVPSVLALGGSAIAVTQYIAQSAGEMRKTLGRYLT
DEVVANLLETPTGLKIGGERRQVTLMFSDLRGFSAISEQLPPEQVVQILNLYLGAMTEVI
NQYKGTINEFIGDGIFVMFGAPISRLDDAERAIACAIAMQLAMQQVNQQNQQMNLPKLEM
GIGINTGEVVAGNIGSQKRAQYTVIGSHVNLAARIETYTVGGQILISENTYRNAKTELKI
TGQLQIEPKGIKEPITIYDIGGIGGEYNLHLPKENDVMVSLLSPIPVEFTVLQGKQATGR
LFSGELVSLTEKQAQLKSAHSLEPLNNLKLRLIDAPDIDIYAKVIKPIDTDYFLIRFTNI
PPEAIAIINSLDKSL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgctagggaaaaaacttaaacccgttatttggcaatggcggggtgtaatatttgcagta
cctaaaattacagttctggtcatcatattacgcttgacaggactgttacaactcctggag
ttggctgcactagatcaattttttctactgcgtccaccagaaccaccagataggcgcatt
gtcatcgttgaaattaacgaggcagatatccaaaatctggggaaatggccgatgtctgat
gaagtattggctagtgttttggcgactatcaaacaacaacaaccaagggcaattggttta
gatatttatcgtgacttacctgtagatcctggacatgaaactctagtcaaactatttgcc
aatacccccaatttagttggtgtgcagaaaatttctaacagctttgatagtgcggctgta
aatccaccgccagcactcaaagaacgtcaacaagtcggctcaaatgatttacctttagat
ggggatgggaaaattcgccggggtttgttgtatgtcaatttcaatgaagaagatgttcta
gaaagttttgctttaaaattggcattgctttatttagaagctgaaggtattactgccaaa
ccatcagctaataatcctgattatttacaactgaatcggggtatcttcccaatttttaca
gcgaatgatggcggttacattcgtgctgatgatggcagttatcaaatattattaaactat
cgcggtaggatgcagcagcaattttctagcatctcgctttcccaactgcaaaacaaccag
atacccccagatttcatgcggggtaaggtagtattaatcggggcaactgcggagagttta
aaggatttattctacacaccttatagtagtaaagtatttgctgctccagaacggatggcg
ggggtaacaattcacgctaatttaattagtcaaattttgagtgcggctttagataatcgt
ccattaattaaaaatttacctgaaccgatagaattactcttaattttattttgctcaatt
attggtgctgctttgtgttggcaacaacgccattatattaaccaaaaaacattcttggca
gtcaacgtaatctttgcaggtggcgttttaattggcagtagttttgtggcttttcttgta
ggttggtggcttcccgttgtgccttcagttttagccttgggaggttcagcgatcgcagtg
acacaatacatcgcccaaagtgctggcgaaatgcgaaaaaccctaggacgatacctcact
gatgaagtcgtcgccaatttattagaaactccgactggtttaaagataggtggggaacgc
cgccaagtcacattaatgttttctgatttacgcggattttcagcgatttcagaacaatta
cctcctgaacaagtggtacaaattcttaacctctatctgggcgcaatgacagaggtaatt
aaccaatataaaggcacaattaatgagtttattggtgatggtatctttgtcatgttcggt
gcgcccattagtcgccttgatgatgcagaacgggcgatcgcctgtgctattgctatgcaa
ttagctatgcagcaggtaaatcaacaaaatcagcaaatgaacctgccaaagctagaaatg
gggattggtatcaataccggtgaagttgtcgctggtaatattggttcacaaaaacgcgcc
caatatacagtcatcggcagtcatgtaaatttagctgcccgtatcgaaacctacaccgta
ggaggacaaattttaatttccgaaaatacttacagaaacgccaaaactgaactcaaaatt
accggacaattacaaatcgaacccaaaggaattaaagaacccattactatttatgacatt
ggtggtatcggtggtgaatataatctgcatttaccaaaagaaaatgatgtcatggtgagt
ttgctatcaccaatccctgtagaatttacagtattacaaggtaaacaagccacagggaga
ttattttctggtgaattggtgagtcttacagaaaaacaagcgcaactcaaatctgcacat
tctctagaacccctcaacaacctcaaactcagattaattgatgcaccagacatagacatt
tatgccaaagtcatcaaaccaatcgatacagattattttttgattcgatttaccaacatt
ccaccagaggcgatcgcaattattaattcactggataaatctctataa

DBGET integrated database retrieval system