KEGG   Nostoc sp. PCC 7524: Nos7524_4231Help
Entry
Nos7524_4231      CDS       T02363                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nop01100  Metabolic pathways
nop01110  Biosynthesis of secondary metabolites
nop01130  Biosynthesis of antibiotics
nop01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nos7524_4231
Enzymes [BR:nop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Nos7524_4231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-ProteinID: AFY49992
UniProt: K9QYY1
LinkDB All DBs
Position
complement(5075669..5076547)
Genome map
AA seq 292 aa AA seqDB search
MTLSIAHLGPPGTYAEQATIIYVKWLTQNTGMETVLRPYPSIAQSLKAVAQGETQLAVVP
VENSIEGSVTMTMDTLWQIDSLRIKSALVMPIAHALISCATSLDRIKTVYSHPQGLAQCQ
NWLGEFLPTVQLIPSNSTTEALQTLQHDLTTAAIASARAAQIYNLPILANNINDYPENCT
RFWVISQTASDIIQHFPVQNPSHTSIAFSVPANVPGALMKPLQVFAQLGINLSRIESRPT
KRSLGEYLFFIDLEAAVDTPKMQSALGEINAYTEVLKIFGSYSLVPISTQEL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgactctatcaattgcccatttaggaccacctgggacttatgcagaacaagccactatt
atctatgtaaaatggctcacacaaaatacaggcatggaaactgttttacgcccctatcct
agtattgcccagtcattaaaagccgtagcccaaggagaaacccagttagctgttgtgcct
gtcgaaaattctattgagggcagcgtcaccatgacaatggatacgctatggcaaatagac
agtttgcgaatcaaatcagctttggtgatgcccattgcccacgcgttaatttcttgtgca
actagcttagataggattaaaactgtttattcccatccccaaggcttggcgcagtgccag
aattggttgggagagtttttacccactgtacaattaattcctagtaattctaccactgaa
gcattacaaactttacaacatgacttaacaacagccgcgatcgcctctgctagagctgct
caaatttacaacttgccgattttagctaataatattaatgattatccagaaaactgcaca
cgcttttgggtaattagtcagacagcatcagatattattcagcatttccccgtacaaaac
cctagtcacacatctatcgcttttagtgtcccggctaacgtaccaggggcattgatgaaa
ccattgcaagtatttgctcaactagggattaacctcagtcggattgagtcacggccgaca
aagcgatcgctaggagagtatttattttttattgacttagaggctgctgtcgatacgcca
aaaatgcaatctgcgttaggggaaataaatgcctacacagaagttttaaaaatatttggt
agttatagtttagtgccaatcagtacacaagagttgtga

DBGET integrated database retrieval system