KEGG   Nostoc sp. PCC 7524: Nos7524_4341Help
Entry
Nos7524_4341      CDS       T02363                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00910  Nitrogen metabolism
nop02010  ABC transporters
Module
nop_M00438  Nitrate/nitrite transport system
nop_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Nos7524_4341
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Nos7524_4341
Transporters [BR:nop02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Nos7524_4341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF4519
Motif
Other DBs
NCBI-ProteinID: AFY50100
UniProt: K9QWV5
LinkDB All DBs
Position
complement(5193833..5194672)
Genome map
AA seq 279 aa AA seqDB search
MAAVLGSRNFRKKSRKNIDKFVAQKVLPPLVALVIFLVIWELLCLTPNLELPGPIETFSE
TWDPFIINPFFDNGASDKGLGWQILSSLGRVGIGFSLAAIAGIILGILIGVNKLVYNAVD
PIFQVLRTVPPLAWLPISLAAFQQANPSAIFVIFITSIWPIIINTTVGVQQIPQDYINVA
RVLKLKGAKYFLKIVFPATVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGSFIWDAYNT
TTETNLSEIILALIYVGLVGLFLDRLVGFVASKVVAEQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgttttaggaagtcgcaatttcagaaaaaaatctcgtaaaaatattgataag
tttgttgctcaaaaagttttaccacctttggtagctttagtaatttttctagtgatttgg
gaattactgtgtttaacacctaatttggaattaccagggccaatagaaactttttctgaa
acttgggatccgtttattattaatcccttctttgataatggtgcaagtgataagggttta
ggttggcagatacttagtagtttgggtagggtagggataggtttttcgttagctgcgatc
gctggtattattctaggtattttaatcggtgtaaataagttggtttacaatgctgtagat
ccgatttttcaagtgttacgcactgtaccgcctctagcatggctaccaatttccttggca
gcatttcaacaagctaatccttccgcaattttcgtgattttcattacttcaatttggccg
attattattaatactactgtcggtgttcaacaaattccccaagactatatcaatgtggct
agagtgttaaaactcaaaggtgcaaagtatttcttgaaaattgtgtttccggcgactgtg
ccttatatcttcacgggtttgagaattgggattgggttgtcttggttggcgattgtggcg
gcggaaatgttagtcggtggtgtggggattggttcttttatttgggatgcttacaacacg
actacggaaactaatttgagtgagattattttggctctgatttatgtgggtttggtgggt
ttgtttttagatagattggtgggttttgtggctagtaaggtggtggcggagcaaaagtag

DBGET integrated database retrieval system