KEGG   Novosphingobium sp. ABRDHK2: FA702_03830Help
Entry
FA702_03830       CDS       T06038                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
nor  Novosphingobium sp. ABRDHK2
Brite
KEGG Orthology (KO) [BR:nor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FA702_03830 (ahpF)
Enzymes [BR:nor01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FA702_03830 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 Glutaredoxin FAD_binding_3 AlaDh_PNT_C DAO Thi4 baeRF_family10 K_oxygenase NAD_binding_8 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: QCI92767
UniProt: A0A4D7D9E9
LinkDB All DBs
Position
complement(757048..758604)
Genome map
AA seq 518 aa AA seqDB search
MPILDAATTGQLKAYLGNLRRPIELVASLDDSPKSAETRSLVEEIAAQSDKVSARFDGTD
ARKPSFAIRADEGRAEAVFAGLPMGHEFTSLILALLHVGGHPPKEDAELLDQVRALEGPL
HFETFFSLTCQNCPDVVQALNIMAALNPNVTHVAIDGAVFQDEVERRKIMAVPTVFLNGE
AFGSGRMDLAQIVAKLDTGAVARAAEKIAAKEPFDVLVVGGGPAGAAAAIYAARKGIRTG
VVAERFGGQVLDTMAIENFISVPHTEGPKLAAHLEQHVKDYDVDVMNVQKAVKLVPPLDG
GLAEVQLESGASLKAKTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQAKLNSLPNVTVITSALTTEVLGN
GDKVTGLKYRDRKSEEVHEIVLEGIFVQIGLVPNTEWLDHSVALTNRGEIEIDARGETSA
AGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcctattctcgatgccgccactaccggccagttgaaagcctatctcggcaacctgcgc
cgcccgatcgagcttgtcgccagcctcgacgacagtcccaaatcggccgaaacgcgcagt
ctggtcgaggagatcgccgcgcagtccgacaaggtgtccgcccgcttcgacggtacggac
gcgcgcaagccttcgttcgcgatccgcgccgacgaaggcagggcggaagcggtcttcgcc
ggcctgcctatggggcacgagttcacctcgctgatcctggcgctgctgcacgtgggcggc
catccgcccaaggaagatgctgaactgctcgatcaggtgcgcgcgctggaagggccgctg
catttcgagacgttcttctcgctcacctgccagaactgccccgatgtggtgcaggcgctg
aacatcatggccgcgctcaacccgaacgtgacgcacgtcgcgatcgacggcgccgtgttc
caggacgaggtggagcggcgcaagatcatggccgtgccgacggtgttcctcaacggcgag
gcgttcggatcggggcgcatggacctggcgcagatcgtggcgaagctcgataccggggcg
gtggcgcgggcagcggagaagatcgccgccaaggagccgttcgacgtgctggtcgtcggc
ggcggccccgccggcgcggcggcggcgatctatgccgcgcgcaagggcatccgcactggc
gtcgtcgccgaacgcttcggcgggcaggtgctcgataccatggcgatcgagaacttcatc
tcggtgccgcacactgaagggccgaagctggccgcgcatctcgaacagcacgtcaaggat
tacgacgtggacgtgatgaacgtgcagaaggcggtgaagctcgtgcccccgctcgatggc
gggctggccgaggtgcagcttgaaagcggcgccagcctgaaagcgaagacggtgatcctt
tcgaccggcgcgcgctggcggcagatgggcgtgcccggcgaggacgaataccgcaacaag
ggcgtcgcctattgcccgcactgcgatggcccgctgttcaagggcaagcgcacggcggtg
atcggcggcggcaactccggtgtcgaagcggcgatcgaccttgcgggcatcgttgcccat
gtcacgctgatcgaattcgacagccagctgcgcgccgatgcggtgctgcaagcgaagctg
aacagcctgcccaacgtcaccgtcatcacctcggccctgaccaccgaagtgctgggcaat
ggcgacaaggtgaccggcctcaagtaccgcgatcgcaagtccgaggaagttcacgaaatc
gtgctggaaggcatcttcgtgcagataggccttgtccccaacaccgaatggctcgaccat
tcggtggcgctgaccaaccgcggcgagatcgagatcgacgcgcgtggcgagaccagcgcg
gcgggcgtgttcgcggcgggtgacgcgacgaccgtgccttacaagcagatcgttatcgcc
atgggcgaaggttcgaaggcggcgctttccgcgttcgattacctgatccggcattga

DBGET integrated database retrieval system