KEGG   Novosphingobium sp. ABRDHK2: FA702_20550Help
Entry
FA702_20550       CDS       T06038                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
nor  Novosphingobium sp. ABRDHK2
Pathway
nor00860  Porphyrin and chlorophyll metabolism
nor01100  Metabolic pathways
Module
nor_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:nor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FA702_20550
Enzymes [BR:nor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     FA702_20550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: QCI96017
UniProt: A0A4D7DJ52
LinkDB All DBs
Position
pABRDHK22:576942..577520
Genome map
AA seq 192 aa AA seqDB search
MKAVALHLLRHGAPLRPGLLLGRTDDAARDPGCARLLAPAMAFDVARIVTSDLRRARASA
EALALARGLPLAVDPRWRELDFGDWDGRAPEDLAQTDLARFWDDPDAWPPPGGERWSALC
YRVGQAIREVGRTTLVVTHAGAMRAAVSALTGLDHRAVWAFDLPYGALLSFRVWPGEKPA
GQITGLQAGGGA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtggcgctgcacctcctgcggcacggtgcgccgctgcggccgggcctgttg
ctgggtcgcaccgacgatgcggcgcgcgatcccggctgcgcaaggctgctcgcgccggcc
atggcgttcgacgttgcgaggatcgttacgtccgatctccggcgcgcgcgggcttcggcg
gaagcgctcgcgctggcgcggggcttgccgctggcggtcgatccgcgctggcgcgaactc
gatttcggggactgggatggccgtgcccctgaagacctcgcgcagaccgatctcgcgcgg
ttctgggacgatcccgatgcctggcctccaccggggggagagcgctggtcggcgctgtgc
tatcgggtagggcaggcgatccgcgaagtcggccgcacgacgctggtcgtgacccacgcc
ggcgcgatgcgcgcggcggtctcggccctgaccgggctggatcaccgcgccgtctgggcg
ttcgacttgccttatggcgccttgctctcgttcagggtctggccgggagagaaaccggcg
gggcagattacgggcctgcaggccgggggcggggcgtga

DBGET integrated database retrieval system