KEGG   Nostoc sp. PCC 7107: Nos7107_1508Help
Entry
Nos7107_1508      CDS       T02362                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nos  Nostoc sp. PCC 7107
Brite
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Nos7107_1508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: AFY42150
UniProt: K9Q911
LinkDB All DBs
Position
1742876..1743478
Genome map
AA seq 200 aa AA seqDB search
MTFTQPPLPFDFNALEAYGMKGETFEYHYGKHHKAYVDNLNKLTENTELADKSLEEVIQI
SFKDSSKAGIFNNAAQVWNHTFFWNSLKPAGGGAPTGDVAARIEKDFGSFDKFKEEFSNA
AATQFGSGWAWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDFRNARPAFI
KNFLDQLVNWDFVAENLAKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacatttacacagccccccttaccctttgattttaatgctctagaggcgtatggcatg
aaaggtgagactttcgagtatcactatggcaagcatcacaaagcttatgtcgataacctc
aacaagctaactgaaaatacagaacttgctgataagtctctagaagaagtcatccaaatc
tcctttaaagattcctctaaagcaggtatcttcaacaatgcggctcaagtttggaaccac
acctttttttggaatagcttgaagccagcaggtggcggcgcacccactggtgacgttgca
gccagaattgaaaaagactttggtagcttcgacaaatttaaagaagagttctcaaatgct
gctgctactcagtttggtagtggttgggcttggttaattgatgatggtggtaccctgaaa
gtaattaaaacacctaacgccgaaaatcccttagcccacggcaaaaaagcattgctcacc
cttgatgtttgggaacacgcatattacatcgacttccgcaatgctcgtccagcattcatc
aagaatttcttagatcagttggttaactgggacttcgttgcagaaaacctggctaaagca
taa

DBGET integrated database retrieval system