KEGG   Nostoc sp. PCC 7107: Nos7107_2625Help
Entry
Nos7107_2625      CDS       T02362                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Nos7107_2625
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Nos7107_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PGM_PMM_II LuxC
Motif
Other DBs
NCBI-ProteinID: AFY43226
UniProt: K9QDH3
LinkDB All DBs
Position
3042564..3044057
Genome map
AA seq 497 aa AA seqDB search
MTLLTCRNYINGQWVDATTRNVLESYNPALVSEVVATFPRSQTEDVDKAVDAARQAYSSW
RKVPAPARAEYIFRVGELLLQHKEELAQLMSREMGKPLTEARGDVQEGIDCAFYSAGEGR
RLFGLTTPSEMPNKFAMTVRMPIGVCALITPWNFPVAIPCWKAMPALVCGNTVILKPAED
TPACATKLVEIFAAAGLPSGVINLVHGVGEEVGKALVEHPNVDLVSFTGSSETGAFVGAT
CGRTHKRVCLEMGGKNAQVVMEDADLGLALDGAVWGAFGTTGQRCTATSRLILHRDIKEK
FTAMLYERTSKLRLGAGYDQDTEIGPIINQKQLQRVNEYMKIAREEGAKILIGGEIASVG
QLKEGNFFLPTILDNVTPDMRVAREEIFGPVVALIEVDSFEEAIAILNDTNYGLSSAIYT
RDINRAFTAMRDIEAGITYINGPTIGAEVHLPFGGVKQTGNGHREAGTTALDVFTEWKSV
YVDFSGNLQRAQIDNRS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgactttgctaacttgtcgcaattatattaatggtcagtgggtggatgctaccacaaga
aatgttctggaaagttataacccagcgttggtaagtgaagttgtcgccacctttccccgt
tctcaaacggaggatgttgataaagccgtcgacgccgcccgtcaagcttacagcagttgg
cggaaagttcccgccccagctagagccgaatatattttccgtgtgggagaattattactc
caacataaagaagaactggctcaattaatgagtcgggaaatgggtaaacccctcactgaa
gctaggggtgatgtgcaggaaggtattgactgtgctttttatagtgctggtgaaggacgg
cggttgtttgggttaacgacaccttcagaaatgccaaataaatttgcgatgacagtgcga
atgcccattggtgtttgtgctttaattacaccgtggaatttccctgtggctattccttgc
tggaaagctatgccggctttggtatgcggtaataccgtcattctcaaacctgctgaagat
accccggcttgtgcaaccaaactggtagagatttttgccgccgcaggtttaccatctggt
gtaattaacttagtgcatggtgttggtgaagaagttggtaaagctttagttgaacatcct
aatgttgatttagtttcgtttactggttcatccgaaacgggggcttttgtgggtgcaact
tgcggacgcactcataagcgtgtttgtctggagatgggcggtaaaaatgcccaagtagtc
atggaagatgcagatttaggactggctttagacggtgcggtttggggggcttttgggacg
actgggcaacgttgtacggctacaagtcggctgatattgcatcgtgacattaaagaaaag
tttacggctatgctgtatgagcgtactagtaagttacgcttgggtgctggttatgaccaa
gataccgaaattgggccgataattaatcaaaaacaattgcaacgggtgaatgaatatatg
aaaattgcccgtgaagaaggtgcaaaaattttaattggtggagaaatagcaagtgttggg
caattaaaagagggtaatttctttttgccaactattttagataatgttacgccagatatg
cgtgttgcccgtgaagagatatttgggcctgtagtggcattaattgaggttgattccttt
gaagaagcgatcgctattctcaatgatactaattacggtctttcttctgccatttatacc
cgcgatatcaaccgggcgtttaccgcaatgcgcgacattgaagcaggtatcacctatatt
aatggcccgactattggcgcagaggtacatttacctttcggtggtgtgaaacaaacaggt
aacggccaccgcgaagccggaaccactgctttagatgtgttcacagaatggaaaagtgtg
tatgttgacttttctggtaatttacaacgcgcccaaatagataatcgaagttag

DBGET integrated database retrieval system