KEGG   Nostoc sp. PCC 7107: Nos7107_3270Help
Entry
Nos7107_3270      CDS       T02362                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00500  Starch and sucrose metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nos7107_3270
Enzymes [BR:nos01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Nos7107_3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AFY43856
UniProt: K9QFC0
LinkDB All DBs
Position
complement(3781195..3783759)
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPPRLEPLRRLAYNLHWDWNVETKDLFRRLDTDLWESSRHNPVLMLGT
ISQARLLEVVEDDGFLAQMDRAARQLEDYLQEGTWYQKQRSQKPKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYPINDFYNM
PLHLERNPDGSELQIAVDYPGRKVYARVWRVQVGMVPLYMLDTNIEPNNQYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYDVTAYHMNEGHAAFSALERIRLLIQEEGLSYAQ
AKQVVMSSNIFTTHTPVPAGIDLFPPDKILYYLGYYADIFGLPKEQFLGLGRENTGDLSA
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWKKVPVEEVPITAITNGVHARSCVAKS
TQELYDRYLGPNWSSVPPENQLWERMEAIPDEELWRNHERCRLDMVLYVREHLVKHLRDR
GASASEIAQAQEVLDPYVLTIGFARRFATYKRATLWMRDLERIKHILLGDKTRKVQFVIA
GKAHPKDIPGKELIRDINHFIHEHHLEKQVVFVPNYDIHIARLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADFVRTGWAIGHGENYEDPNYQDEVEANALYDLL
EKEVVPLFYDHRDDDGLPRPWVAKMKDAIRLNCPFFNTARMVRDYAQQAYFPASDRCHTL
IADNYAPAKELAAWKAKLSDHWFNLIIKDIDVSVGSDIKVNQSVAVKAKVDLATLSNDDI
QVELYQGVIDANGEIVNATPVVMDYQGQDSQGLSVYTADIIYNTSGLQGLSLRVLPKHPH
LSNAYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgcacttttaatgtttccccatcactaccaccgcgcctggaaccactg
cgacggctggcatataatttgcattgggattggaatgttgagacaaaagatttatttcgc
cgtttagatacggatttatgggaatctagccgccataacccagtgttgatgctgggtact
atctcccaagcgaggctgttggaggtagtggaagatgatggctttttagcacaaatggat
cgtgctgcccgtcaattagaggattatctccaagaaggaacttggtatcagaaacaacgc
agtcaaaagcccaaagaatgttatgcctatttttcggcagaatttggcttggttgactgt
ttacctgtttattctggtggtttgggcgttctggctggtgatcacctaaaatcggctagt
gatttgggactacccctcgtgggtgtgggcttgctttatcaacaagggtattttgctcaa
tatctcaacgctgatggctggcaacaagagcgctaccccatcaacgatttttataatatg
cccttgcatttggaacgcaatcccgacggttcagaattgcagattgctgttgattatccg
gggcgcaaggtgtacgccagagtgtggcgggtacaggtgggaatggtgcctttatatatg
ttagacaccaacatcgaacccaataaccaatacgatcacgacatcacagatcagctgtat
ggtggcgatatcgatatgcgtatccaccaagaaattatgttggggatcggtggtgtgcag
atgctcaaagctttgggttatgatgtcaccgcctaccacatgaatgagggacatgctgcc
ttctcggctttagagcgcatccggctgttgattcaagaagaaggtttgagctatgcccaa
gctaaacaggtggtgatgtctagcaacatctttacaactcacacacctgtacctgcggga
attgacttgttccctcccgataagattttgtattatctgggatattatgcagatattttt
ggcttacccaaagagcaatttttaggattggggcgagaaaatacgggcgatttatctgca
ccgtttagtatggcagtgctggcgttgaaaatggcgacgttttctaacggggtggcgcag
ctacatggtgtggtatcgcggcaaatgtttcaaggattgtggaagaaagtcccagtcgaa
gaagttccaatcacagctattactaacggtgttcacgcccgcagttgtgtagctaaatca
actcaagagttgtacgatcgctacttagggccaaactggtcgtcagtaccaccagagaac
caactgtgggagcgaatggaagccattcccgatgaggagttgtggcgcaatcacgaacgc
tgccgcttggatatggtactttacgtgcgagagcatttagttaagcatttacgcgatcgc
ggtgcttcggcttcggaaattgcccaagcccaagaagtattagatccttatgttttaacc
attggttttgcccgacggtttgctacttataaacgcgctaccctgtggatgcgcgatcta
gaacgcattaaacacatcttactcggtgataaaacccgtaaagtccaatttgtcattgct
ggtaaagctcaccccaaagatattccgggaaaagaactgattcgtgatatcaatcacttt
atccacgaacaccatttagaaaaacaggttgtttttgttcctaactacgatattcatatc
gctcggttaatggtagcgggttgcgatatctggttgaacacaccccgtcgtccacgggaa
gcttccggtactagcgggatgaaagccgcgatgaatgggttgccaaatttaagtgtttta
gatggttggtgggatgaagctgattttgtccgcacaggttgggcgattggacatggcgaa
aattacgaagatcccaattatcaagatgaagtggaagctaacgctctctacgatttgtta
gagaaagaagttgtgcctctattttatgaccaccgagacgatgatggtctgcctagacct
tgggtcgccaaaatgaaagatgcaattcgcttgaactgtccgttctttaatacagcgcgg
atggtacgggattatgctcaacaggcttatttcccagccagcgatcgctgtcatactctg
attgctgataattacgccccagctaaggaattagctgcttggaaagctaaactcagcgac
cactggtttaacctcattatcaaagatattgatgtctcagttggttcagatattaaggtt
aaccaaagcgttgctgtcaaggccaaagtggatttagcaactttgagcaatgatgatatc
caagtggagttatatcaaggcgtaattgatgctaacggtgaaatcgttaatgcgacacca
gtagtcatggattaccaaggccaagattctcaaggcttgagtgtctacacggcagatatt
atctacaatacctctggtttacaaggcttgtccttgcgtgtgttacctaagcacccacac
ttgtctaatgcttatgaaccaagattaattgcttgggcggaatag

DBGET integrated database retrieval system