KEGG   Nostoc sp. PCC 7107: Nos7107_3818
Entry
Nos7107_3818      CDS       T02362                                 

Definition
(GenBank) Nitric-oxide synthase
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00220  Arginine biosynthesis
nos00330  Arginine and proline metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Nos7107_3818
   00330 Arginine and proline metabolism
    Nos7107_3818
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     Nos7107_3818
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 Globin
Other DBs
NCBI-ProteinID: AFY44378
UniProt: K9QGA7
LinkDB
Position
4449286..4453731
AA seq 1481 aa
MDYDQQLINLTEISATDVPSGGDFKYKCRVQILSEQGQSVLSKDLFSRMQPSWLLNLTNY
KDCAITITLCYRQGDMTQPWQDAGTVTFAAQDFLHGHNSIELEFPITTWSLAPYLTLKTR
ITQTIGEANSSTVNLLANQQSHTRVQLKPTSTTDKEVEIPAAIPLTANEEVIVKDVWNKL
RAWKELQMEKFFKRLLLEEPELEHIFGEAIDSITDYFYELFDYCIHQLQPHTQNIISEPL
TGVPYEKGDDFDTVEDYGALFADIGMRPHHWVKARQVWMWMLPSIPYLEEYDRQDLAKGV
NSALYKFFNTHIIVPMVEAVRCYEDALPQELLQEMTDTWQIFSQNKQEMGMVFYQTLFEK
YPFVLPIFGRADIDYLSLHLFQSLDFLMRCLKSETTDELLLELRLLGQIHGNVGVPSCAY
PAISDTMFVLFEKYVPNFTPELRRAWQTLFNRVTNVMKLPKLNEERLLKKAKQFLEVIAT
EQGWEPEHQKLRWAEIQAEVQATGAYSHTYEELAYGAQLAWRNASKCIGRIQWNNMVVRD
CRHVTDPDEMFKELVEHLRLGTNGGNIQVIMTAFRPKQPKERWGPRLWNPQLLRYAAYEQ
PDGSVIGDRANLDLTKAVIKLGWQPPSPRTPYDILPIVIEVPGMEPKLYEFPQDEILEID
IEHPSISEFKSLGLRWYAIPAISNFRMDIGGITYACVPFNGWYMGTEIMRDFMEEGRYDK
LEDIAKVLQLDISSEQTLWRDRVALELNIAVLYSFQKAKVTMVDHQSASRQYLAHDLREK
KAGRECPAEWGWVMPPAGGSACPVWHHQTRDFYLEPAYHHAADRWAVEDGIDLEKITTFA
SEDDNKQDRILILYASETGTAEGFARTVARQLNRYRPKVMELDEYNPDLLASEKLLLIVT
STFGNGEMPGNGKKFLHWLKKQPPGSLMSLNYSVLGLGSTVYEHFCAAGIAVDKALARSG
ANSIAPLHKADEIKGQADTFKQWVRLISRVLGEDATAADGTTAHAPQLQVKVLNVAEVLN
LSCIIGSGDRGIAVPVVANQELLQEVIPGSRSTRFISFDIANTNLTYETGDHVAVYPCNS
SALVQRICDRLNVTQDTYFSASYVTADGQETEDKPPVAVPTTVGHVLHEELDLALREPFN
DLLAYLHSATSNLTEKQRLETWLEILRQGEDHPDSIALTKNITDNYMSVADLFDEFPAAK
ITLAALLELLPRQKPRLYSISSCPLLHPQEIQITVGVLQITTDAGKVRQGLCSNYLAGLE
VGTTVRIDVRTSTFRPPSDPEAMMLMVGPGTGVSPLIGFLQYRQALWQQGQPLADAALFF
GCRNHQDFLYQEQLQTWYNQGVLSELNVAFSRQGGEKVYVQHLMQRKPQEIWQLLSHPKC
HYYVCGDAKMADDVYEVMLAIANTEGGLSHLEAVQFFDKMKQEKRFTADVWGITLNYKQA
IKQVQKDNYSKAQRWLDRVNQSADDQAQVPEVATPSIAYNI
NT seq 4446 nt   +upstreamnt  +downstreamnt
atggattacgatcaacaactgattaatttaacagaaatctcagctacagatgttccatct
ggaggagattttaaatataaatgtcgtgtacagatactttctgagcaaggacaatctgtt
ttatccaaggatctgttttcgcggatgcagcccagctggttgttgaatttaactaactac
aaagactgcgcgatcaccattacactgtgttatcgccaaggcgatatgacgcaaccttgg
caagatgccgggacagttacctttgcggcgcaagattttctgcatggtcacaactcaatt
gaactagaatttcccatcaccacctggagtctggcaccctacttaaccctgaaaacacgg
atcacccagactattggtgaagcaaatagcagcaccgtcaacttattagccaatcagcaa
agccatacgcgtgttcaactgaaaccaacctcaacaaccgacaaagaagtagaaattccc
gcagctattcccctgacagccaatgaagaagtcatcgtcaaggatgtctggaataagcta
cgggcttggaaagaactgcaaatggaaaagttctttaaacggctgttgctagaagaacca
gaactagaacatatctttggtgaagcgatcgacagcataacagattacttttatgagtta
tttgattactgtattcaccaactccagccccacacccaaaacattatttctgaacctctc
acaggtgtgccttacgaaaaaggcgatgacttcgatacagtagaagactacggggctttg
tttgcggatattgggatgcgtccccaccactgggtaaaagcgcgacaagtgtggatgtgg
atgttaccctcgattccttatctggaagaatacgatcgccaagatttagctaaaggtgtt
aattctgcgctttacaagtttttcaatacccatatcattgtcccaatggtagaagcagtc
cgttgttatgaagacgctttaccacaagaattactccaggagatgacagacacttggcag
atatttagccaaaacaagcaagaaatggggatggtattttatcagaccttatttgaaaaa
tatccctttgtgttgccgatttttggcagggcagatattgattacctatctttgcacctg
tttcaatcattggattttctcatgcgttgcttgaaaagcgaaaccactgatgaactgttg
ctggaactgcgattattaggacaaattcacggcaatgtgggagtaccatcttgtgcatac
cctgccatttcggacaccatgtttgtcttatttgaaaagtatgtgccgaattttacccca
gaattacggcgggcatggcagacattgtttaatcgcgtcaccaatgtgatgaagttgcct
aagctgaatgaagaaaggttattaaaaaaagccaagcaatttctcgaagtgattgcgact
gaacaaggttgggaaccagaacatcaaaaactacgttgggcagaaattcaagcagaagtt
caagccacaggtgcttacagtcatacctacgaagaactcgcctatggcgcacagttagct
tggcggaatgcttccaaatgtattggtcggattcagtggaataatatggtggtgcgtgat
tgccgtcatgttaccgaccctgatgaaatgttcaaagaattagtcgaacatttgcgttta
gggacaaatggcggcaatattcaagtgatcatgaccgcatttcgtcccaaacaaccgaaa
gaacgttgggggcctcgcctgtggaatccccaattactgcgttacgccgcctacgaacaa
ccagatggcagtgtgataggcgatcgcgctaacttagatttaactaaagcagtgatcaaa
ctaggttggcaaccaccatcaccccgcaccccttacgatattttaccgatagtgattgaa
gtgccgggaatggagccaaagctttatgaattcccccaagacgaaattttagaaatagac
attgaacatcccagcattagcgaattcaaatctttagggttgcgctggtatgccatccct
gccatcagtaatttccgtatggatattggtggcattacttacgcttgcgtcccctttaat
ggctggtacatgggtacagaaatcatgcgtgatttcatggaagaaggacgttacgacaaa
ctcgaagacatcgccaaagtactgcaattagatattagttccgagcagaccttgtggcgc
gatcgcgtcgccttagaattgaatattgctgtcctgtactccttccaaaaagcgaaggta
acaatggtagatcatcaatctgcctcgcgccagtacctcgcccacgatttgcgcgaaaag
aaagcaggtagagagtgtccggcggaatggggttgggtgatgccaccagccggcggtagc
gcttgtccggtttggcatcatcaaacacgggacttttatttagaaccagcctatcaccat
gcagccgatcgctgggcagtagaagatgggattgacctggaaaaaatcacgacttttgct
tctgaagacgacaataagcaagaccgcattttgattttatatgcctcagaaactggcaca
gccgaaggttttgcccggactgtagcacggcaattaaatcgttatcgtcccaaggtgatg
gaactggatgagtacaaccccgaccttttagcttcggagaaactactactaattgtcacc
tccacctttggtaatggggaaatgccagggaacggcaaaaaattcttgcattggttgaaa
aagcaaccgcctggttccctgatgagtttaaattattctgtgttggggctgggtagtacc
gtatacgaacacttctgtgcggcaggaattgcggttgataaagccttagctcgctcaggg
gcaaactctatcgctcccttacataaagctgacgaaatcaaaggacaagccgacaccttt
aaacagtgggtgagattaattagtcgtgttttaggtgaagatgccacagccgccgatggg
actacggctcatgcgcctcaattgcaggtgaaagtgttgaatgtcgccgaagttctcaat
ctttcttgtattatcggcagtggcgatcgcggtatagccgttcctgtagttgcaaatcaa
gaattgctgcaagaagtaattcccggtagccgttccacccgatttatcagcttcgatatt
gctaataccaacctgacgtatgaaacaggcgatcatgtggcagtgtatccttgcaactca
tcagcattggtgcagcgaatttgcgatcgcctgaatgtcactcaagacacctacttcagt
gctagttacgttaccgctgatggtcaggaaaccgaagacaaacccccagttgccgtacct
acaactgtcggtcatgtgctacatgaagagctagatttagccttgcgggaaccattcaat
gatttattggcatatttacactccgccacatcaaacctcacagaaaaacaacgcctagaa
acttggttagaaattctccgccaaggtgaagaccatcccgacagcatcgcgctcaccaaa
aatatcaccgacaattacatgagcgtggctgacttattcgatgaattccccgccgccaaa
attaccctcgccgccttactagagttactccccagacagaaaccccgtctgtactccatt
tcctcctgtcccttgctacatccccaagaaattcaaatcacagtgggggtattgcaaatt
accaccgatgcaggcaaagtccgtcaagggctgtgttccaactacctagctggattggaa
gtaggcacaacagtaagaattgacgttcgtacctccaccttccgtccacccagtgatcca
gaagcaatgatgttgatggtaggcccaggtactggggtttcaccgttaattggcttcttg
caataccgacaagccctgtggcaacaaggacaacccttagcagacgcagctttattcttt
ggttgtcgtaatcaccaggacttcctctatcaagagcaattgcagacatggtacaaccag
ggcgtgctatcagaattaaacgtggctttttctcgccaaggcggagaaaaagtctacgtt
caacatttgatgcagcgcaaaccccaagaaatctggcaactgttgagtcatccaaaatgc
cactattatgtttgtggtgatgccaaaatggccgatgatgtttatgaagtcatgttagcg
atcgccaatactgaaggtggtttatcacacctagaagctgtccagttctttgacaaaatg
aaacaggaaaaacgcttcactgccgatgtttggggaatcacactcaactacaaacaagcc
atcaaacaagtgcagaaagataactactcaaaagcccaaagatggctggatcgtgttaat
caatcggcagatgatcaggcacaagttccagaggtagcaacaccatccattgcctataat
atttga

DBGET integrated database retrieval system