KEGG   Nostoc sp. PCC 7107: Nos7107_4397Help
Entry
Nos7107_4397      CDS       T02362                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00473  D-Alanine metabolism
nos01100  Metabolic pathways
nos01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Nos7107_4397
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Nos7107_4397
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nos01011]
    Nos7107_4397
Enzymes [BR:nos01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Nos7107_4397
Peptidoglycan biosynthesis and degradation proteins [BR:nos01011]
 Precursor biosynthesis
  Racemase
   Nos7107_4397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFY44932
UniProt: K9QJF3
LinkDB All DBs
Position
5132206..5133393
Genome map
AA seq 395 aa AA seqDB search
MLSRDQVTSVASHQQCDTYAWFSQRAWVEIDLDALSHNVQQIKQLLSPRTQLMAVVKADA
YGHGAVTVAQTALQSGASWLGVATVPEGIQLREAGIQAPILILGATQTPEQIHAIAHWNL
QPTLCSPKQALIFSNILEAINYGSPVSVHIKLDTGMSRLGTNWQDAAEFVQLVERLPHLT
IKSVYSHLATADSPDPAIMEEQHRRFKSAIAQIQKIGIKIPSLHLANTAATLADSQLHYD
MVRVGLGVYGLAPASHLKQKIHLKPVLQVKARITQVKTIAAGTGVSYGHQFVADREMRLA
VVAIGYADGIPRNLSNKMQVLLRGQRIPQIGAITMDQLMIDISNIPDIQEGEIVTLLGDQ
GKEQITADDWAEQLNTISWEILCGFKHRLPRVGVI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgctaagtcgtgatcaagtgactagtgttgcatctcatcaacaatgcgacacttatgcg
tggttttcccagcgtgcttgggtagaaattgatttagatgcgttgtcgcacaatgtacag
caaataaagcagttgttatcaccacgtactcagttgatggcggtagtcaaagctgatgct
tatggacacggagcagtcacagtcgcgcaaacggcattacaatcgggagcgagttggtta
ggagtcgccactgttccagaggggattcaattacgggaagcaggaatacaagcgccgata
ttgattttaggcgcaacccaaacaccagagcaaattcatgcgatcgcccattggaatctc
cagccaacattgtgcagtcccaaacaagctttaattttttccaacattttagaagcaatt
aactacggctcccccgtatctgtacatattaaattagatacgggaatgtctcggttagga
actaattggcaagacgcagccgagtttgtacagttagtagaacgcttaccgcatttgact
atcaagagtgtttactctcacttagccactgctgatagtcctgatccagcgattatggaa
gaacagcatagaagatttaaaagtgcgatcgcccaaattcaaaaaatcggcattaaaatt
cctagcttgcacttagcaaacacagccgccactctcgcagattcccaactgcactacgac
atggtaagagtgggtttaggcgtttacggtcttgctcctgcatctcatttaaaacaaaaa
attcacttaaaacctgtgttacaggtaaaagcacgcatcactcaagtcaaaactatcgcc
gctggtactggtgttagctatggccatcaatttgtagctgatagagaaatgcgccttgcg
gttgtagctatcggctacgctgatggtataccgcgcaacctttctaataagatgcaggta
ttgttacgcggtcagcgaatacctcaaattggcgcaattacaatggatcagttgatgatc
gatatcagtaatattcctgatattcaagaaggggaaattgtgactttactcggcgaccaa
ggaaaagaacaaatcactgctgatgattgggcagaacaattaaatactatttcttgggaa
attctttgcgggtttaagcatcgcctaccgcgtgttggggttatttag

DBGET integrated database retrieval system