KEGG   Nostoc sp. PCC 7107: Nos7107_5299Help
Entry
Nos7107_5299      CDS       T02362                                 

Definition
(GenBank) Glutathione S-transferase domain protein
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5 DUF3869
Motif
Other DBs
NCBI-ProteinID: AFY45788
UniProt: K9QK70
LinkDB All DBs
Position
complement(6152008..6152679)
Genome map
AA seq 223 aa AA seqDB search
MSDIQLYFAKASTFSQRTRVVLLEKNIDFTPIEIDLQNKPDGYTQISRYGKVPAIKHGDF
IVYESAIINEYLDEVFPEPPLLPRDPAKKAQARIWIDYANTRFVPAFNKFLRGKDTQEQE
QGRKEFTEALLYIEQEGLGKGEYLLGNEFSLVDISFYPWFERLPLLEHFRKFTLTAETPR
LQIWWNLVRHRSSIKTVANPVDFYLQRFAKILGEPIPVGAAQK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatacaactttactttgctaaagcatctactttctctcaacgcacccgtgta
gtattgctggaaaaaaacattgactttacgccgatagaaattgacttacagaataaacca
gatgggtatacgcagatttcccgttatggtaaagttccggctatcaaacatggcgatttt
atagtctacgaatctgcgattatcaatgaatatttagatgaagttttccccgaaccaccc
ttattaccgcgcgatccggcaaaaaaagcacaggctcgcatctggatagattatgctaat
actcgctttgtccccgcttttaacaaatttctccgtggtaaagatacccaagaacaggaa
caaggaagaaaagagttcacagaagcacttctatatattgaacaagaaggattaggcaaa
ggtgaatatttgttaggaaatgagtttagccttgtagatatcagtttctatccttggttt
gaacgtttaccactgttagaacacttccgtaagttcacactaacagcagaaacacctcgt
ttgcagatatggtggaatttggtaagacatcgctcctcaattaaaacagtagcaaatcct
gtagatttctatttacaaagattcgccaaaattcttggtgaaccaattcccgttggtgca
gcgcaaaaatag

DBGET integrated database retrieval system