KEGG   Nostoc sp. PCC 7107: Nos7107_5328Help
Entry
Nos7107_5328      CDS       T02362                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00620  Pyruvate metabolism
nos00680  Methane metabolism
nos00710  Carbon fixation in photosynthetic organisms
nos01100  Metabolic pathways
nos01120  Microbial metabolism in diverse environments
nos01200  Carbon metabolism
Module
nos_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nos7107_5328
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nos7107_5328
   00680 Methane metabolism
    Nos7107_5328
Enzymes [BR:nos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Nos7107_5328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFY45813
UniProt: K9QKA1
LinkDB All DBs
Position
6186676..6189726
Genome map
AA seq 1016 aa AA seqDB search
MSSLLYSVSHAANYYPASELFLRRRLQIVEELWENVLRQECGQKMVDLLRQLRDLCSPEG
QATNDQAASAVKLIEQLNINEAIRAARAFALYFQLINIIEQEYEQKQQLTRYSEIEIESK
NAETVSDSSYSSNDKEDDAFVNTGIGSDLLAKNWVNKMHNKQKGTFATLFPHLYDLNVPP
QQIQRLISQLDVRLVFTAHPTEIVRHTIRDKQRQVVNLLQQIDAVENRVGAYPWESGELR
EKLLEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLHKRFKYALSKTFDWL
EPPRKNFCAFGSWVGSDRDGNPSVTPEITWKTACYQRKMVLERYIQSVKKLIELLSISMH
WSDVLPDLLESLELDQSHLSDIYDALALRYRQEPYRLKLAYVLRRLENTRDRNLALYKRE
TPTNEDAPMYRSGADFLAELRLIQHNLSETGLSCRELENLICQVEIFDFNLTQLDIRQES
TRHSDALNEILEYLQVLPQAYDDLTEEQRVAWLTAELQTRRPLIPAELPFSEKTNDVIET
FRILRSLQQEFGVNICQTYIISMCRQVSDVLEVLLLAKEARLFDPAIAVGTVQVVPLFET
VEDLQRSRSIMRQLFELPLYRALLAGGYENIQQRLATPESSPHSVLTPDLQEVMLGYSDS
NKDSGFLSSNWEIHKAQKSLQKIAEDYGVNLRIFHGRGGSVGRGGGPAYEAILAQPGHSI
NGRIKITEQGEVLASKYSLVDLALYNLETVTTAVIQASLLRTGFDDIEPWNEIMEELAAR
SRQHYRALIYEQPDFIDFFNQVTPIEEISQLQISSRPARRPSGKKDLSSLRAIPWVFSWT
QTRVLLPSWYGMGTALQEFLNEEPEEHLKLLRYFYMKWPFFKMVISKAEMTLAKVDMQMA
RHYVQELSNPEDKERFDKVFEQIASEYYLTRDFVLKITGHNRLLDGDPVLQRSVQLRNGT
IVPLGFIQVSLLKRLRQAKNTTATSGVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgcttttatactctgtgtcacacgctgcgaattattaccctgcatcagaacta
tttttacgtcgtcgcctccaaatagttgaagaattatgggagaacgtcctgcggcaagaa
tgcggacagaaaatggtagacttattacggcagttgcgagatttgtgttcgccagaagga
caagccacaaatgaccaagccgcctccgctgttaaattgattgaacaactaaatattaat
gaagcgattcgggcagcgcgggcttttgcgctgtatttccagctaattaacatcatagag
caggaatacgaacaaaagcagcaattaacccgctattcagaaatcgaaatagaatccaag
aatgcagaaactgtctctgatagtagctactcttccaacgacaaagaagatgatgcgttt
gttaacacaggtataggttcagacttgttagccaaaaattgggttaacaaaatgcacaac
aaacagaaaggtacttttgctactctgtttccccatctatacgatttgaatgtcccaccc
caacaaattcaacgcctaatttcgcaactggatgtgcgtttggtgttcacagcccacccc
acagaaatcgtccgtcacaccatccgcgataaacagcgacaagtagtcaatctcctgcaa
cagatagatgcagtagaaaatcgtgttggtgcttatccttgggaatcaggggagttacgg
gaaaaactgctggaagaaattcgcctatggtggcgtaccgatgaactccatcagttcaaa
cctacagtcttagatgaagtagattatgccctgcactacttccaagaagtattatttgat
ggcattcctcaactgcataagcggttcaaatatgctttgagtaaaacttttgattggttg
gaaccaccgcggaaaaacttttgtgcgtttggttcttgggtaggttccgatagagatgga
aacccatcagtcacaccagaaatcacctggaagacagcttgttatcagcgcaaaatggta
ctggagcgttatattcagtcagtgaaaaagctgattgaattgttaagtatatccatgcac
tggagtgatgttttaccagatttattagaatctctggaattagatcagtcacatttaagt
gatatatatgatgccctagcgttgcgttatcgccaagaaccttatcgcttgaaactggct
tatgtacttagaaggttggaaaatacccgcgatcgcaatttagcattatataaacgggaa
actcccaccaacgaagatgcacctatgtatcgttcgggagccgactttttggcagaattg
cggttaattcagcataatttgagcgaaactggactgagttgtcgagaactggaaaatctg
atttgtcaagtcgaaatctttgactttaacctgacacaattagatattcgtcaagaatca
acacgccattccgatgcgctgaatgagattttagaatatctgcaagtattaccccaagct
tatgatgatctaacagaagaacagcgagttgcttggttaaccgcagaattgcaaacccgc
aggccattaattccagcggaactgccattttctgagaaaaccaacgatgtcattgaaacc
tttagaattttgcgatcgctgcaacaagaatttggtgtcaacatctgccaaacttatatt
attagtatgtgccgtcaagtcagcgacgtactagaagttttactcttagccaaagaagcc
agattatttgacccagccattgccgtcggcacagttcaagttgtacccttatttgaaacc
gtagaagacttgcagcgttcccgcagcatcatgcgccagctgtttgaacttcccttatat
cgggctttattagctggtggctacgaaaatattcagcaaagactggcgacacctgaatca
agtccgcactcagttctcacccccgacttgcaagaagtcatgctggggtattccgacagc
aacaaagactccggcttcttaagtagcaactgggaaattcataaagcccaaaaatcatta
cagaaaattgccgaagactacggcgtgaacttgcgaatttttcacggtcgcggcggttct
gtggggcggggtggcggccctgcttatgaggcgattttagcccaaccaggacacagtatt
aacgggcgaattaaaattaccgaacaaggagaagtattagcctcgaaatattccttggtg
gatttagctttatacaacttagaaaccgtcaccaccgccgtcatccaagcaagtttgctg
cggacagggtttgatgatatcgaaccttggaacgaaattatggaagaactagcagcgcga
tcgcggcaacactatcgtgctttaatctacgaacaaccagatttcatcgactttttcaac
caagtcacccccattgaagaaattagccaactgcaaatcagttcccgtccagcacgccga
ccttctggtaaaaaagatttaagcagtctccgggcgattccttgggtatttagctggaca
caaacgagagttttgctaccttcctggtatggtatggggacagcgttgcaagaattctta
aatgaagaaccagaagaacacctcaaattactacgctacttttatatgaagtggccgttc
ttcaaaatggtgatttccaaagccgaaatgaccttggcaaaagtcgatatgcaaatggcg
cgacactacgtccaggaattatccaatccagaagacaaagaacggtttgataaagtgttc
gagcaaatcgccagcgagtactatttaaccagagattttgtcctgaaaattacgggacac
aatcgacttttggatggtgatccagtgttgcagcgttcagtacaattacgtaatgggaca
attgtccctctaggtttcatccaggtttccctactcaagcgcctgcgccaagccaagaat
actacagctacctctggtgtcattcactcccgttacagcaaaggcgaactactccgaggc
gcactgttaaccattaatggtattgctgcagggatgcgaaatacaggttga

DBGET integrated database retrieval system