KEGG   Novosphingobium sp. THN1: C7W88_02945Help
Entry
C7W88_02945       CDS       T05635                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
not  Novosphingobium sp. THN1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh HCV_NS4a
Motif
Other DBs
NCBI-ProteinID: AXU18225
UniProt: A0A3B7DKE6
LinkDB All DBs
Position
complement(581912..583381)
Genome map
AA seq 489 aa AA seqDB search
MTPEGVNVAHPDKLFIGGRWVAAHSGRMIDLISPNTEQVVGRVAEADAADMDAAVAAARE
AFDNGPWPTTPPAERIAAFRRMVAHLETRVPELARAWTAQMGGLASFAGPMHGGSVMALG
QIAGFAEQFEFVERRPSMAADTALIAYEPVGVVAAIAPWNGPFGIMANKVAYALLTGCTV
IMKPSPETPLEAYIIAEAAQAAGIPAGVVNLVTGHREASDHLVCNEGVDKVSFTGSTVAG
KRIASVCGARMARCTLELGGKSAAIVRDDFPIDAAAKMLAGTITMMSGQVCAMLSRVIVP
RHRHDELAEAIAAEMRQVRIGHSDDPETQLGPVAMKRQLERIEMFIEEGRASADLVTGGG
RPAHLNRGYFIEPTLFANVKNESRIAQEEIFGPVLSLIPVEDEEDAIRTANASAYGLNGS
VLTTDADAAYRIARRVRTGGFGQNGLRMDFGLPFGGFKQSGIGREGGPEGLFPYLEMKTI
LIDAMPSAL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgactcccgaaggcgttaacgtcgcccatcccgacaagctcttcatcggcggccggtgg
gtggccgcccactccgggcggatgattgacctcatctcgcccaataccgagcaagtcgta
ggccgcgtggccgaggcggacgcggcggacatggacgcggcggtagcagcggcgcgcgag
gcattcgacaatggtccgtggccaacaacgccgccggcagagcgcatcgctgccttccgt
cgcatggttgcccaccttgaaacacgggtgccggaactggcccgggcgtggacagcgcag
atgggcgggctcgcctcgtttgccgggccgatgcatggcggcagcgtgatggcgctcggc
cagatcgccgggtttgccgaacagttcgaattcgtggaacgccgcccgagcatggccgcg
gatacggcgctcatcgcctatgaaccggtaggtgtggtcgcggcgattgcgccgtggaac
ggcccgttcgggatcatggccaacaaggtcgcctatgcgctgctgacgggctgcacggtg
atcatgaagccatcgccggaaacgccgctcgaggcctatatcatcgccgaggcggcgcag
gcggcgggcattccggcaggcgtggtgaacctcgtcaccggacaccgtgaggcgagcgac
catctcgtctgcaacgagggcgtcgacaaggtcagcttcaccggtagcaccgttgccggc
aagcgcatcgccagcgtctgcggggcgcggatggcgcgatgcacgctggagctgggcggc
aagtccgcggctatcgtgcgcgatgatttcccgatcgatgctgccgcgaagatgttggca
ggcaccatcacgatgatgagcgggcaggtctgcgccatgctcagccgggtgatcgtgcca
cgccaccgccatgacgaactggccgaagccatcgccgcagaaatgcggcaggtccggatt
ggccattccgatgaccccgaaacccagcttggcccggtggcgatgaaacgccagctcgaa
cgcatcgagatgttcatcgaggagggcagggccagcgccgatctcgtcaccggtggcgga
cgtccggcgcatctcaaccgcggctatttcatcgaaccgaccttgttcgccaacgtgaag
aacgaaagccggatcgcgcaggaggagatcttcggcccggtcctcagcctgatcccggtc
gaggacgaggaagacgcgatccgcactgccaatgccagcgcctatggcctcaatggttcg
gtgctgacgacagacgccgacgccgcctaccgcatcgcccggcgcgtacgcaccggcggc
ttcgggcagaacggcttgcgcatggacttcggcctgccgttcggcgggttcaagcaatcg
ggcattggccgggaaggtggcccggaaggcctgtttccctacctcgagatgaagacgatc
ctgatcgacgcaatgccgtcggcactttga

DBGET integrated database retrieval system