KEGG   Natronococcus occultus: Natoc_0017Help
Entry
Natoc_0017        CDS       T02426                                 

Definition
(GenBank) 4-acetamidobutyryl-CoA deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
nou  Natronococcus occultus
Pathway
nou00220  Arginine biosynthesis
nou01100  Metabolic pathways
nou01110  Biosynthesis of secondary metabolites
nou01130  Biosynthesis of antibiotics
nou01210  2-Oxocarboxylic acid metabolism
nou01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nou00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Natoc_0017
Enzymes [BR:nou01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Natoc_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AGB35900
UniProt: L0JUE8
LinkDB All DBs
Position
complement(19555..20859)
Genome map
AA seq 434 aa AA seqDB search
MDERTATKRVEDAIADRADELLALLEDLVAAKSVTGHEPRGQAVICEAFDDLGLEVDTWE
PRAEALADHPGFFRTSSYEEHGYEGRENAVATLSGTGDGPTLALSGHVDVVPADPESAWE
SDPWTLRREGDELYGRGVSDMKGGLAAMLVAVDALQDEDVELAGDLYVQSTIEEEAGGVG
GLLSVLERGYVPDAAIVPEPFGLPNVGIASAGVMFFDVTVPGKKAHAAWGHQGVSAFDKA
CLVRKALEELNDERQAAIDFPPAYGADPDLEGHVTNINLGVVEGGDWPASVPAEVTLKGR
VGWPPGETRAEVREAIEGAIADVADGDEWLSENPPTVEWTGWNAAPHEVPRDAEIVEIVK
NNAESITGESGTFVGGNAALDERFYQRYYDVPVVTAGPYGPNLHGVDEYTTLTSLVETAQ
TLATSAIDYCGLAK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacgaacggcgacgaagcgagtcgaggacgcgatcgcagaccgggcagacgag
ctgctggcgctgctcgaggatctcgtcgcggcgaagtcggtgacgggacacgaaccgcgg
ggacaggcggtgatctgcgaggcgttcgacgacctcggcctcgaggtcgatacctgggag
ccacgcgccgaggcgcttgccgaccaccccggtttcttccggacgtcctcgtacgaggag
cacggctacgaggggcgggagaacgcggtagcgactctctcgggaaccggcgacggaccc
acgctcgcgctctccgggcacgtcgacgtcgttcccgccgaccccgaatcggcctgggag
tccgacccctggacgttgcgccgcgagggtgacgagctctacggccgcggcgtctccgat
atgaagggcgggctcgccgcgatgctcgtcgccgtcgacgccctgcaagacgaggacgtc
gaactcgccggcgacctctacgttcagagcacgatcgaggaggaggcgggcggggttggc
ggcctcctctccgtcctcgagcgggggtacgttcccgatgcggcgatcgtcccggagccg
ttcggcctgccgaacgtcggcatcgccagcgctggggtgatgttcttcgacgtcaccgta
ccagggaagaaggcccacgccgcctggggtcaccagggcgtcagcgccttcgacaaagcc
tgcctcgttcggaaggccctcgaggagctaaacgacgagcggcaggcggccatcgacttc
ccgcccgcctacggcgccgatcccgacctcgagggccacgtgacgaacatcaatctgggc
gtcgtcgagggcggagattggcccgcctcggtgcccgcagaggtgaccctgaagggacgc
gtggggtggccgcccggagagacccgtgccgaggttcgcgaggcgatcgagggagcgatc
gccgacgtcgccgacggggacgagtggctgtccgagaacccgccgacggtggagtggacg
ggctggaacgcggcacctcacgaggttccccgggacgccgagatcgtcgagatcgtcaag
aacaacgccgagtcgatcaccggcgagtcgggaaccttcgtcggcgggaacgccgcgctc
gacgagcggttctatcagcgctactacgacgtcccggtcgtcacggcgggtccctacggg
ccgaacctccacggcgtcgacgagtacaccaccctcacgtcgctggtcgagaccgcccag
acgctcgcgacgtcggcgatcgactactgcgggctcgcgaagtaa

DBGET integrated database retrieval system