KEGG   Natronococcus occultus: Natoc_1446Help
Entry
Natoc_1446        CDS       T02426                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nou  Natronococcus occultus
Pathway
nou00564  Glycerophospholipid metabolism
nou01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nou00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Natoc_1446
Enzymes [BR:nou01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Natoc_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 FAD_binding_2 FAD_binding_3 3HCDH_N Pyr_redox NAD_binding_8 ApbA FAD_oxidored Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGB37257
UniProt: L0JW53
LinkDB All DBs
Position
1408929..1410149
Genome map
AA seq 406 aa AA seqDB search
MDNRTDVLVVGGGATGTGIARDLALRGVDVTLAERGGLSAGTSGRSHGLLHSGARYAEAD
EPEARACLEESRTLTEIAGACVRETDGLFVQLSEDDPDYFEAKHEACAEVGIETEVLDGE
TVRAEIPDLSDDVERAMRVPDGVVFPSRLVAANAADAREHGAEILTHAPVTDMRREDGRI
AEVELGGEVDGTIEPTYVVNAAGPYASSIAETVGATVELRPTRGVMVSVDYDRLEPVLNR
CRDPNDGDIVVPHDDEVVLGTTSVPVDDPEEYERADWEIERSVEECAKMLPAVADAAHLR
TWWGVRPLYEPEEAALGARGISRGFHLLEHGEEGVDNLATIVGGKLTTYRKMAEATADLV
CEQLGVDADCETATRRLPGADDPERLDALVAEFDGQGPTDEDVVGR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccgaaccgacgtcctcgtcgtcggcgggggcgccaccggtaccggaatcgcc
agggacctcgcccttcggggcgtcgacgtcaccctcgccgaacggggcgggctctcggcg
ggcacctccgggcgctcacacggcctgctccacagcggtgcccgctacgccgaggccgac
gagcccgaggcccgggcctgtctcgaggagagccgtacgctcaccgagattgcgggtgcc
tgcgtcagggagaccgacggactgttcgtccagctgagcgaggacgaccccgactacttc
gaggccaagcacgaggcctgcgccgaggtcgggatcgagaccgaagtcctcgacggcgag
accgtccgcgccgagatcccggatctcagcgacgacgtcgagcgggcgatgcgggtcccc
gacggcgtcgtcttcccctcgcggctggtcgcggcgaacgcggccgacgcccgcgagcac
ggcgccgagatcctgacccacgccccggtgacggacatgcgccgcgaggacggccggatt
gccgaggtcgagctcggcggtgaggtcgacgggacgatcgagccgacgtacgtcgtcaac
gccgcgggaccctacgcgtcgtcgatcgccgagacggtcggcgcgacagtggagctccgt
ccgacgcggggcgtgatggtctcggtcgactacgaccgcctcgagccggtgctcaaccgc
tgtcgggatcccaacgacggcgacatcgtcgtcccccacgacgacgaggtcgtcctcggg
acgaccagcgtccccgtcgacgaccccgaggagtacgagcgggccgactgggagatcgaa
cgctccgtcgaggagtgtgcgaagatgctgccggccgtcgccgacgccgcccacctgcgg
acctggtggggggtccgtcccctctacgagcccgaggaggcggccctcggcgcgcgcgga
atctcgcggggctttcacctgctcgagcacggcgaggagggcgtcgacaacctcgcgacg
atcgtcggcgggaagctaaccacctaccggaagatggccgaggcgacggccgacctggtt
tgcgagcagctcggcgtcgacgccgactgtgagaccgcgacccgacggctcccgggcgcg
gacgatcccgagcgcctcgacgccctggtcgccgagttcgacggacagggacccaccgac
gaggacgtcgttggtcgctga

DBGET integrated database retrieval system