KEGG   Natronococcus occultus: Natoc_2036Help
Entry
Natoc_2036        CDS       T02426                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nou  Natronococcus occultus
Pathway
nou00010  Glycolysis / Gluconeogenesis
nou00053  Ascorbate and aldarate metabolism
nou00071  Fatty acid degradation
nou00280  Valine, leucine and isoleucine degradation
nou00310  Lysine degradation
nou00330  Arginine and proline metabolism
nou00340  Histidine metabolism
nou00380  Tryptophan metabolism
nou00410  beta-Alanine metabolism
nou00561  Glycerolipid metabolism
nou00620  Pyruvate metabolism
nou00625  Chloroalkane and chloroalkene degradation
nou01100  Metabolic pathways
nou01110  Biosynthesis of secondary metabolites
nou01120  Microbial metabolism in diverse environments
nou01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nou00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natoc_2036
   00053 Ascorbate and aldarate metabolism
    Natoc_2036
   00620 Pyruvate metabolism
    Natoc_2036
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Natoc_2036
   00561 Glycerolipid metabolism
    Natoc_2036
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Natoc_2036
   00310 Lysine degradation
    Natoc_2036
   00330 Arginine and proline metabolism
    Natoc_2036
   00340 Histidine metabolism
    Natoc_2036
   00380 Tryptophan metabolism
    Natoc_2036
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Natoc_2036
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Natoc_2036
Enzymes [BR:nou01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Natoc_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGB37822
UniProt: L0JXT0
LinkDB All DBs
Position
complement(1957443..1958927)
Genome map
AA seq 494 aa AA seqDB search
MTLPITDDWSELYVDGEWTPSESGEELTVEDPSTRESIASVPAAVEDDVDAAYEAAAAAQ
SAWGDRPPAEREELLQDVVDGLEERHDEIVELLTSEAGGSQIMGETSLQLATDQAAEAAT
LPRRMKGQHAASNVPGKENVVERVPEGVVTVISPWNFPLNLSMRAVAPAIAAGNAVVLKP
ASNTPITGGLLLAKLFEDAGVPDGVLNVVTGKGSEIGDRIAGHPESDVVAFTGSTPIGRQ
VAATAGENLAEAAMELGGNNAHIVTEDADLEDAVDAGVFGTFVHQGQVCISINRHLVHED
VYDEYVERLTERAESLPAGSAHDDDTVVGPIIDESQREEMLGYVEETVEAGATLETGGET
VEIDGVDDSLIVAPTVLSGVTNEMAAACNEHFGPIAPVIPFSDIDEAVELHNAVEYGLSG
SVHAGDVGAGRRIADRLETGMVHINDQPINDEAHVPFGGTGASGIGSYNAEAFLEEITER
KWLSLQHDSREYPF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactctaccaatcaccgacgactggagcgagctgtacgtcgacggggagtggacgccg
tccgaaagcggcgaggagctgaccgtcgaggacccctcgacgcgggagtcgatcgcgtcg
gttcccgcggccgtcgaggacgacgtcgacgcggcctacgaggccgccgcggccgcccag
tcagcgtggggagaccgcccgcccgcagagcgcgaggagctgttgcaggacgtcgtcgat
gggcttgaggagcgccacgacgagatcgtcgagctgctcacaagcgaggccggcggctcg
cagatcatgggcgagacgtcgctccagctggcgaccgatcaggccgccgaggcggcgacg
ctgccccgccggatgaaaggccagcacgccgcctccaacgttccggggaaggaaaacgtc
gtcgagcgtgtccccgagggagtggtcacggtgatctcgccgtggaacttcccgctaaac
ctctcgatgcgagcggtcgcgccggcgatcgccgccgggaacgcggtcgtgctcaagccc
gcctccaatacgccgatcacgggcggactgttgctcgcaaagctgttcgaggacgccggg
gttcccgacggcgtcctcaacgtcgtcaccgggaaggggtcggagatcggcgatcggatc
gccggccaccccgagagcgacgtcgtcgccttcaccggatcgacgccgatcggccgccag
gtcgccgccaccgccggcgagaacctcgctgaggccgcgatggagctgggcgggaacaac
gctcacatcgtcaccgaagacgccgacctcgaggacgccgtcgacgccggcgtcttcggc
acgttcgtccaccagggacaggtctgtatctcgatcaaccgccacctggtccacgaggac
gtctacgacgagtacgtcgagcggctgaccgagcgcgccgagtcgctgccagccggcagc
gcccacgacgacgacaccgtcgtcgggccgatcatcgacgagagccagcgcgaggagatg
ctcggctacgtcgaggagaccgtcgaggcgggcgcgactctcgagaccggcggcgagacg
gtcgagatcgacggggtcgacgactcgctgatcgtcgcgccgacggtcctctcgggggtg
acgaacgagatggccgcggcctgtaacgaacacttcggtccgatcgcacccgtgatcccg
ttctcggatatcgacgaggccgtcgagctccacaacgccgtcgagtacggcctctcggga
tcggtccacgcgggcgacgtcggcgcgggacggcggatcgcggaccgcctcgagaccggg
atggtccacatcaacgatcagccgatcaacgacgaggcccacgtccccttcggcggcacc
ggcgcctccgggatcggcagctacaacgccgaggcgttccttgaggagatcaccgaacgg
aagtggctctccctgcaacacgactcccgggagtacccgttctag

DBGET integrated database retrieval system