KEGG   Novosphingobium sp. P6W: TQ38_000220Help
Entry
TQ38_000220       CDS       T05550                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00860  Porphyrin and chlorophyll metabolism
nov01100  Metabolic pathways
Module
nov_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TQ38_000220
Enzymes [BR:nov01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     TQ38_000220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AXB75117
UniProt: A0A2Z5E698
LinkDB All DBs
Position
1:47237..47806
Genome map
AA seq 189 aa AA seqDB search
MTEILVHLMRHGIPVQPNLLLGQRDDAPLPSGTAKCVAAAEGLAFERVISSDLSRAHIPA
ARIAAARGASHTVDARWRELDFGAWTGLAPTQVDPAAHARFWEDPEANAPPEGERWSQLS
ARVGAALAGIDASTLILTHGGAMRAALAALFHMEHRHVWSFDLPYSCVLTLRVWPGEAVP
IAQIVGLTT
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatcctcgtccacctcatgcgccacggcatcccggtccagccgaacctgctg
ctcggccagcgcgacgatgcccccctccccagcggaaccgccaagtgcgtggcggcggca
gaggggctggcgttcgagcgggtgatctcctccgacctttcgcgcgcccacatcccggcc
gcccggatcgccgctgcgcgcggcgcttcgcataccgtggatgcccgctggcgcgaactc
gacttcggcgcatggaccggcctcgcccccacgcaggtggaccccgccgctcacgcccgc
ttctgggaagaccctgaggcgaacgccccgcccgaaggcgaacgctggtcccagctcagc
gcccgcgtcggcgcggcgctggccgggatcgatgcctccaccctcatcctgacccacggc
ggcgcgatgcgcgcggcgctggcggcattgttccacatggaacatcgccacgtctggtcc
ttcgacctgccctattcctgcgtccttaccttgcgcgtgtggccgggtgaggctgtgccg
atcgcgcagatcgtgggcctgaccacatga

DBGET integrated database retrieval system