KEGG   Novosphingobium sp. P6W: TQ38_000390Help
Entry
TQ38_000390       CDS       T05550                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00061  Fatty acid biosynthesis
nov00780  Biotin metabolism
nov01100  Metabolic pathways
nov01130  Biosynthesis of antibiotics
nov01212  Fatty acid metabolism
Module
nov_M00083  Fatty acid biosynthesis, elongation
nov_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TQ38_000390
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TQ38_000390
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    TQ38_000390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nov01004]
    TQ38_000390
Enzymes [BR:nov01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     TQ38_000390
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     TQ38_000390
Lipid biosynthesis proteins [BR:nov01004]
 Fatty acid synthase
  Component type
   TQ38_000390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1598
Motif
Other DBs
NCBI-ProteinID: AXB75144
UniProt: A0A2Z5E671
LinkDB All DBs
Position
1:78221..79024
Genome map
AA seq 267 aa AA seqDB search
MTGLMHGKRGLIMGLANDKSLAWGIAKKLHEQGAELAFSYQGEALAKRVRPLAESLGSDF
LIDCDVSNMEALDTAFAQIEERWGKIDFLVHAIGFSDKNELRGKYVDTSLDNFLMTMNIS
AYSLVAVTKRALPMMSAGGSIVTLTYYGAEKVVPHYNVMGVAKAALEASVKYLANDLGPQ
GIRVNGISAGPIKTLAASGIGDFRYILKWNELNAPLRRNVTIEDVGGAGLYLLSDLSSGV
TGETHHVDCGYHVVGMKQEDAPDIALA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtctgatgcacggtaagcgcggcctcataatgggccttgcaaatgacaagtcg
ctggcctggggaatcgccaagaagctgcacgaacaaggcgccgaactcgccttttcctac
cagggcgaagctctggccaagcgggtgaggccgctggccgagagcctgggcagcgatttc
ctcatcgattgcgacgtgtccaacatggaagcgctcgacactgccttcgcgcagatcgag
gaacggtgggggaagatcgacttcctcgtccacgccatcggcttctccgacaagaacgaa
ctgcgcgggaaatacgtcgacaccagcctcgacaacttcctgatgaccatgaacatctcg
gcctacagcctggtggcggtgacgaagcgggcgctgccgatgatgtcggcgggcggttcg
atcgtgacgctgacctactacggcgccgagaaggtggttccgcactacaacgtcatgggc
gtggccaaggccgcgcttgaggcttcggtgaagtatcttgccaacgacctggggccgcag
ggcatccgcgtcaacggcatctccgccggaccgatcaagacgctggcggccagcggaatc
ggcgatttccgctatattctcaagtggaacgagctgaacgcccccctgcgccgcaacgtg
acgatcgaggatgtgggcggtgcgggtctgtacctgctgtccgacctgtcttcgggcgtg
accggcgaaacccatcatgtggactgcggctatcacgtcgtcggcatgaagcaggaagac
gccccggatatcgccctcgcctga

DBGET integrated database retrieval system