KEGG   Novosphingobium sp. P6W: TQ38_002790Help
Entry
TQ38_002790       CDS       T05550                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
nov  Novosphingobium sp. P6W
Brite
KEGG Orthology (KO) [BR:nov00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TQ38_002790
Enzymes [BR:nov01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TQ38_002790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 Glutaredoxin HI0933_like FAD_oxidored K_oxygenase Spermine_synth DAO FMO-like FAD_binding_3 NAD_binding_7 AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AXB75568
UniProt: A0A2Z5E7K2
LinkDB All DBs
Position
1:complement(569034..570635)
Genome map
AA seq 533 aa AA seqDB search
MLDPALKQQLSQYLAMLREPIELVASLGDDGKSTETRELLTTIASLSDKVTATFDGDDAR
RPSFIIRRASDASAWVRFAGLPLGHEFTSLVLALLWTGGHPPKVSDEVLEQIRLLEGSTD
FEMYFSLSCHNCPDVVQALTLISLNNPHVNATLIEGGTFQAEVEERGVMAVPAVFLNGKM
WGSGKMSVEEILTKLDTGADAKAAAKLAEKKPFEVLIVGGGPAGAAASVYTARKGFSTGI
AAERFGGQVQDTMGIENFISVPYTEGPKLAAALEAHVAEYDIDVMNLQRAEKLIPATELG
GYHEVVFANGASLKARSLVLTTGARWRNLGVPGEEQYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLANIVGHVTLIEFDAKLRADQVLVDKLASMKNVDIFTSAQTTEVEGD
GEKVNALVYKNRETGVEHKVELEGVFVQIGLVPNTEWLKDSGVELTPRGEIVIDEKAATN
LPGIFAAGDVTTVPYKQIIIAMGEGSKAALSAFDYLIRNEAPEEIAQAAQQAA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccccgccctgaagcaacagctctcgcaatacctcgccatgctgcgcgagccg
atcgagctggtcgcctcactgggcgacgacggcaagtccaccgaaacgcgcgagttgctg
accaccatcgcctcgctctcggacaaggtcaccgccactttcgacggcgatgatgcgcgc
cgtcccagcttcatcatccgccgcgcctccgacgcaagcgcctgggtgcgcttcgccggc
ctgccgctcggccatgaattcacctcgctggtcctcgctctgctgtggaccggcggccat
ccgcccaaggtttccgacgaggttctggaacagatccgcctgctggaaggcagcaccgat
ttcgagatgtacttctcgctctcgtgccacaactgccccgatgtggtgcaggcgctgacg
ctgatctcgctgaacaacccgcacgtcaacgcgacgctgatcgaaggtggcacgttccag
gccgaagtcgaggagcgcggcgtcatggccgttcccgccgtcttcctgaacggcaagatg
tggggctcgggcaagatgagcgttgaggaaatcctcaccaagctcgacaccggcgccgac
gccaaggcggctgcgaagctggcagaaaagaagcctttcgaggttctgatcgtcggcggc
ggacctgccggggccgcagcatcggtctacaccgcgcgcaagggcttctcgaccggcata
gccgccgaacgcttcggcgggcaggtgcaggacaccatgggtatcgagaatttcatctcg
gttccctataccgaaggccccaagctggccgccgcgctggaagcccacgtcgctgaatac
gacatcgacgtaatgaacctccagcgcgccgagaagctgatcccggccaccgaattgggc
ggctatcacgaagtggtgttcgccaacggcgcttcgctgaaggcccgcagcctggtgctg
accaccggtgcgcgctggcgcaacctgggtgttcccggcgaggagcagtacaagaacaag
ggcgtggcctattgccctcactgcgacggcccgctgttcaagggcaagcgcgtagcggtg
atcggcggcggcaactccggcgtggaggcggcgatcgacctggccaacatcgtcggccat
gtcacgctgatcgaattcgacgccaagctgcgcgccgaccaggttctggtcgacaagctg
gcctcgatgaagaacgtcgatatcttcacctccgcccagaccaccgaggtcgaaggcgac
ggcgagaaggtcaatgcgctggtctacaagaaccgcgagacgggcgttgaacacaaggtc
gagctggaaggcgtgttcgtccagatcggtctggtgcccaataccgaatggctgaaggac
agcggcgtggaactgacgccgcgcggcgagatcgtcatcgacgagaaggccgccaccaac
ctgcccggcatcttcgcggcaggcgacgtgaccacggtgccgtacaagcagatcatcatc
gccatgggcgaaggttcgaaagcggcactgtccgcattcgactacctgatccgcaacgag
gcgcccgaggaaatcgcacaggctgcccaacaggccgcctga

DBGET integrated database retrieval system