KEGG   Novosphingobium sp. P6W: TQ38_006440Help
Entry
TQ38_006440       CDS       T05550                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00970  Aminoacyl-tRNA biosynthesis
nov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nov00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TQ38_006440 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nov03029]
    TQ38_006440 (gatB)
Enzymes [BR:nov01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     TQ38_006440 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     TQ38_006440 (gatB)
Mitochondrial biogenesis [BR:nov03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TQ38_006440 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey AAA_17
Motif
Other DBs
NCBI-ProteinID: AXB76194
UniProt: A0A2Z5E9A4
LinkDB All DBs
Position
1:1326015..1327511
Genome map
AA seq 498 aa AA seqDB search
MSTYRIQGATGDWEVVIGLEVHAQVTSNSKLFSGSATAFGAEPNSQVSLIDAAMPGMLPV
LNGECIRQAVRTGMAIDAQINKWSRFDRKNYFYADLPQGYQISQLYHPIVGEGSLTIEAD
EKAGIPEAKVIGVERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSRPDMNSPAEA
GAYLSKLRTILRYVGSCDGNMDQGSMRADVNVSVRRPGDELGTRTETKNVNSVRFVMQAI
EHEANRQVDVIEGGGKIVQETRLFDPNTGSTRSMRSKEDAHDYRYFPDPDLLPLVLEDAF
LEDCRASLPELPDAKRARYEGELGLSAYNAAVLTADVDTFRWFEALLAETALAQDKQPAE
VAKQAANWLISELFGALNKLGKSLDESPVSHEQAAELLGLVGKGTISGSIAKQVLETMLE
TGEGATAIVEREGLKQESDTGAIEAKVDEILAANGDKVEQYRGGKVALFGFFVGQTMKAM
QGKANPGVINEILKSKLG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtatcgcatccagggcgccaccggggactgggaggtcgtgatcggcctagaa
gtccacgcgcaggtcacttccaattccaagctgttctccggctcggctacagccttcggg
gcggaaccgaacagccaggtgtcgctgatcgacgcggcgatgccgggcatgttgcccgtg
ctgaacggcgaatgcatccgccaggccgtgcgcaccggcatggccatcgacgcgcagatc
aacaagtggtcgcgcttcgaccgcaagaactacttctacgccgatctgccgcagggctac
cagatcagccagctttaccacccgatcgtcggcgaaggctcgctgaccatcgaggcggac
gagaaggccggcattcccgaggccaaggtcatcggcgtggagcgtatccacgtcgagcag
gacgcgggcaagctgatgcacgatcagcacccgacgatgtcctatgtcgacctcaaccgt
tcgggcgtggcgctgatggaaatcgtcagccgtcccgacatgaactcgcccgcagaggct
ggcgcctatctgtccaagctgcgcacgatcctgcgctatgtcggctcgtgcgacggcaac
atggaccagggctcgatgcgcgccgacgtcaacgtgtcggtgcgccgccccggtgacgaa
ctgggcacccgtaccgagacgaagaacgtcaactcggtgcgcttcgtcatgcaggcaatc
gagcacgaagcgaaccgtcaggtcgacgtgatcgagggcggcggcaagatcgtgcaggaa
acccgcctgttcgacccgaacaccggatcgacccgctcgatgcgctcgaaggaagacgcg
cacgactatcgctacttcccggaccccgacctgctgccgctggtactggaggatgcattc
ctcgaggactgccgcgcatcgctgcccgaactgcccgacgccaagcgcgcgcgctacgaa
ggcgaactggggctttccgcttacaacgccgccgtgctgaccgccgacgtcgacacgttc
cgctggttcgaggcgctgctcgcggaaactgcgttggcacaggacaagcagcccgccgaa
gtcgccaagcaggcggccaactggctgatttccgaactgttcggcgcgctcaacaagctg
ggcaagtcgctcgacgaatcgcccgtcagtcatgaacaggcggcggagctgctggggctg
gtcggcaaggggacgatttccggctcaatcgccaagcaggtgctggagaccatgctggaa
accggcgaaggcgccaccgccatcgtcgagcgcgaaggcctgaagcaggaaagcgacacc
ggtgccatcgaagccaaggtggacgagatcctcgccgccaatggcgacaaggtggaacag
taccggggcggcaaggttgcgctgttcggcttcttcgtcggtcagacgatgaaggccatg
cagggtaaggccaaccccggcgtcatcaacgaaatcctcaagtccaagctgggctga

DBGET integrated database retrieval system