KEGG   Novosphingobium sp. P6W: TQ38_007775Help
Entry
TQ38_007775       CDS       T05550                                 

Definition
(GenBank) zinc-binding dehydrogenase
Organism
nov  Novosphingobium sp. P6W
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N TrkA_N Glu_dehyd_C Methyltransf_11 IlvN Methyltransf_25 TPMT Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AXB76418
UniProt: A0A2Z5EAI1
LinkDB All DBs
Position
1:1610846..1611859
Genome map
AA seq 337 aa AA seqDB search
MKRLNIHGVGDVRLDTYERPEAGPNDVVVRMKSVGICGSDLSYIKIGGMPAEPSGQTALG
HEGAGEVLQVGSGVSGIAVGDAVIVNPMMTPSNIGSGGPEGAFTEELLVREAQLGTSILP
IPEGVDFDVAAMCEPLAVAMHGVNRAEVKPGDKVVVFGCGPIGLGMLLWLKDRGVNEVVA
LDLSEERLERARAIGVQAALDPSKVDLRAELARLHGEVPSFNRVGVGTDAFIDAAGAPHI
LTQVVMMAKFHARLVITAAYMKPIEFPVGRMLTSEMTITTAVGYPTEMPEVIAAMPRLKN
QIAAMISHKLPFDDVLHGLEIAATPQSAKVMIQFEDA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtctgaacatccacggtgtcggcgacgtccgcctcgatacatatgagcggccc
gaggctggtcccaacgacgtggtcgtgcggatgaagtcggtgggcatctgcggcagcgac
ttgtcctatatcaagatcggtggaatgcctgccgagccgagcgggcagaccgcgctgggg
catgaaggtgcgggcgaagtgcttcaggtcggctccggcgtcagcggcattgccgtaggc
gatgcagtgatcgtcaatccgatgatgacccccagcaacatcggttcaggcggcccggaa
ggcgccttcaccgaagaactgctggtacgcgaggcccagcttggcacatcgatcctgccg
atcccggaaggcgtcgatttcgacgtagcggcgatgtgcgagccgctcgccgtcgccatg
cacggcgtcaaccgcgcagaggtgaagccgggcgacaaggtggtggtgttcggctgcggc
ccgatcggccttggcatgttgctatggctgaaggaccggggcgtgaacgaggtggtggcg
ctggacctttcggaagagcggctggaacgtgcccgcgccatcggcgtccaggcagcgctg
gacccgagcaaggtggacctgcgcgcggaactggcaaggctgcacggcgaagtgcccagc
ttcaaccgcgtgggcgtgggcaccgatgccttcatcgatgcggcaggcgcgccgcacatc
ctgacgcaggtcgtcatgatggccaagttccacgcccgactggtgataacggcggcctac
atgaagcccatcgaatttccagttggccgcatgctgaccagcgagatgaccatcaccacg
gcggtcggctaccccaccgaaatgcccgaggtgatcgccgcgatgccgcgcctcaagaac
cagatcgcggcgatgataagccataagctgccctttgatgacgtactgcacgggctggaa
atcgccgccacgccgcagtccgccaaagtcatgatacagtttgaggacgcctga

DBGET integrated database retrieval system