KEGG   Novosphingobium sp. P6W: TQ38_008385Help
Entry
TQ38_008385       CDS       T05550                                 

Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nov01100  Metabolic pathways
nov01110  Biosynthesis of secondary metabolites
nov01130  Biosynthesis of antibiotics
nov01230  Biosynthesis of amino acids
nov02024  Quorum sensing
Module
nov_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TQ38_008385
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    TQ38_008385
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TQ38_008385
Enzymes [BR:nov01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     TQ38_008385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 Herpes_UL21
Motif
Other DBs
NCBI-ProteinID: AXB76517
UniProt: A0A2Z5EA31
LinkDB All DBs
Position
1:complement(1736075..1736686)
Genome map
AA seq 203 aa AA seqDB search
MILVIDNYDSFTWNLVHYVMELGAEVQVVRNDALSVSLAMDMGAQGFLVSPGPCTPNEAG
ISLGLVGAAAKAGIPVLGVCLGHQSIGQYFGGKVVRGGLMHGKTSMIDHDGTGLFAGIPS
PLKAARYHSLIVENIPDALAVNARSDDGHVMGFRHVDLPIHGVQFHPESIATQHGHAMLA
NFLRVCGIDARIPDRILSAAKAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgttatcgataactacgacagcttcacctggaacctcgtccattacgtcatg
gaactgggcgcggaagtccaggtggtgcgcaacgacgcgctgagcgtcagcctggccatg
gacatgggcgcgcagggcttcctcgtctcgcccggcccctgcaccccgaatgaggctggc
atcagcctcgggcttgtcggcgcggcagctaaggcaggtatcccggtgctcggggtctgc
ctgggccaccagtcgatcggccagtatttcggcggtaaagtcgtgcggggcggacttatg
cacggcaagacatcgatgatcgaccacgacggcaccggcctcttcgcgggcatcccctca
ccgctcaaggccgcgcgctatcactcgctcatcgtcgagaacattcccgatgcgctggcg
gtaaacgcccgctcggacgatggccatgtcatgggctttcgccatgtcgacctgcccatc
cacggcgtccagttccacccggaaagcatcgccacccagcatggccacgcgatgctggcg
aacttcctgcgcgtctgcgggatcgatgcccgcatccccgatcgcatactctccgcagcg
aaggccgcatga

DBGET integrated database retrieval system